SDCBP2 (syndecan binding protein 2)

Gene

• Entrez ID: 27111
• Gene name: Syndecan binding protein 2
• Gene symbol: SDCBP2
• Synonyms (NCBI Gene): SITAC, SITAC18, ST-2, ST2
• Chromosome: 20
• Chromosome location: 20p13
• Summary: The protein encoded by this gene contains two class II PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins, and PDZ-containing proteins mediate cell signaling and the organiza

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1331586	hsa-miR-4504	CLIP-seq
MIRT1331587	hsa-miR-4677-3p	CLIP-seq
MIRT1331588	hsa-miR-4679	CLIP-seq
MIRT1331589	hsa-miR-491-3p	CLIP-seq
MIRT1331590	hsa-miR-542-3p	CLIP-seq
MIRT1331591	hsa-miR-549	CLIP-seq
MIRT1331592	hsa-miR-622	CLIP-seq
MIRT1331593	hsa-miR-146b-3p	CLIP-seq
MIRT1331594	hsa-miR-3173-5p	CLIP-seq
MIRT1331595	hsa-miR-3943	CLIP-seq
MIRT1331596	hsa-miR-4763-5p	CLIP-seq
MIRT1331597	hsa-miR-874	CLIP-seq
MIRT1331594	hsa-miR-3173-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11102519, 11152476, 16189514, 21516116, 25416956, 27107012, 31515488, 32296183
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	15961997
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005730	Component	Nucleolus	IDA	15961997
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11152476, 15961997
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	11152476
GO:0005886	Component	Plasma membrane	IDA	15961997
GO:0005886	Component	Plasma membrane	IEA
GO:0007399	Process	Nervous system development	NAS	11152476
GO:0008283	Process	Cell population proliferation	IMP	15961997
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA	15961997
GO:0016607	Component	Nuclear speck	IEA
GO:0035556	Process	Intracellular signal transduction	NAS	11152476
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012
GO:0042803	Function	Protein homodimerization activity	IDA	11152476
GO:0046907	Process	Intracellular transport	NAS	11152476
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	11152476
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

Other IDs

• MIM: 617358
• HGNC: 15756
• e!Ensembl: ENSG00000125775

Protein

• UniProt ID: Q9H190
• Protein name: Syntenin-2 (Similar to TACIP18) (SITAC) (Syndecan-binding protein 2)
• Protein function: Binds phosphatidylinositol 4,5-bisphosphate (PIP2). May play a role in the organization of nuclear PIP2, cell division and cell survival (PubMed:15961997).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17820	PDZ_6	131 → 186	PDZ domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Preferentially expressed in cells of the digestive tract (PubMed:11102519). Low expression in skeletal muscle and kidney (PubMed:11102519). Detected in differentiated keratinocytes of normal and malignant epithelium (PubMed:22623796).
• Sequence:

  MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSS
  QEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTG
  LRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKI
  VVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNV
  IGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA

• Sequence length: 292

<