Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	27111
Gene name	Syndecan binding protein 2
Gene symbol	SDCBP2
Synonyms (NCBI Gene)	SITACSITAC18ST-2ST2
Chromosome	20
Chromosome location	20p13
Summary	The protein encoded by this gene contains two class II PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins, and PDZ-containing proteins mediate cell signaling and the organiza

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments
MIRT1331586	hsa-miR-4504	CLIP-seq
MIRT1331587	hsa-miR-4677-3p	CLIP-seq
MIRT1331588	hsa-miR-4679	CLIP-seq
MIRT1331589	hsa-miR-491-3p	CLIP-seq
MIRT1331590	hsa-miR-542-3p	CLIP-seq
MIRT1331591	hsa-miR-549	CLIP-seq
MIRT1331592	hsa-miR-622	CLIP-seq
MIRT1331593	hsa-miR-146b-3p	CLIP-seq
MIRT1331594	hsa-miR-3173-5p	CLIP-seq
MIRT1331595	hsa-miR-3943	CLIP-seq
MIRT1331596	hsa-miR-4763-5p	CLIP-seq
MIRT1331597	hsa-miR-874	CLIP-seq
MIRT1331594	hsa-miR-3173-5p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11102519, 11152476, 16189514, 21516116, 25416956, 27107012, 31515488, 32296183
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	15961997
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005730	Component	Nucleolus	IDA	15961997
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11152476, 15961997
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	11152476
GO:0005886	Component	Plasma membrane	IDA	15961997
GO:0005886	Component	Plasma membrane	IEA
GO:0007399	Process	Nervous system development	NAS	11152476
GO:0008283	Process	Cell population proliferation	IMP	15961997
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA	15961997
GO:0016607	Component	Nuclear speck	IEA
GO:0035556	Process	Intracellular signal transduction	NAS	11152476
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012
GO:0042803	Function	Protein homodimerization activity	IDA	11152476
GO:0046907	Process	Intracellular transport	NAS	11152476
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	11152476
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
617358	15756	ENSG00000125775

Q9H190

Protein name

Syntenin-2 (Similar to TACIP18) (SITAC) (Syndecan-binding protein 2)

Protein function

Binds phosphatidylinositol 4,5-bisphosphate (PIP2). May play a role in the organization of nuclear PIP2, cell division and cell survival (PubMed:15961997).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17820	PDZ_6	131 → 186	PDZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in cells of the digestive tract (PubMed:11102519). Low expression in skeletal muscle and kidney (PubMed:11102519). Detected in differentiated keratinocytes of normal and malignant epithelium (PubMed:22623796).

Sequence

MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSS
QEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTG
LRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKI
VVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNV
IGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA

Sequence length

292

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	36835443	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	36209503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	36835443	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Inhibit	34218800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Inhibit	36209503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	32377223	★★★★★ ★☆☆☆☆ Found in Text Mining only

SDCBP2 (syndecan binding protein 2)