SDCBP2 (syndecan binding protein 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27111
Gene name Gene Name - the full gene name approved by the HGNC.
Syndecan binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDCBP2
Synonyms (NCBI Gene) Gene synonyms aliases
SITAC, SITAC18, ST-2, ST2
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p13
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains two class II PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins, and PDZ-containing proteins mediate cell signaling and the organiza
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT1331586 hsa-miR-4504 CLIP-seq
MIRT1331587 hsa-miR-4677-3p CLIP-seq
MIRT1331588 hsa-miR-4679 CLIP-seq
MIRT1331589 hsa-miR-491-3p CLIP-seq
MIRT1331590 hsa-miR-542-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11102519, 16189514, 21516116, 25416956, 27107012, 31515488, 32296183
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding IDA 15961997
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA 15961997
GO:0005737 Component Cytoplasm IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617358 15756 ENSG00000125775
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9H190
Protein name Syntenin-2 (Similar to TACIP18) (SITAC) (Syndecan-binding protein 2)
Protein function Binds phosphatidylinositol 4,5-bisphosphate (PIP2). May play a role in the organization of nuclear PIP2, cell division and cell survival (PubMed:15961997).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17820 PDZ_6 131 → 186 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Preferentially expressed in cells of the digestive tract (PubMed:11102519). Low expression in skeletal muscle and kidney (PubMed:11102519). Detected in differentiated keratinocytes of normal and malignant epithelium (PubMed:22623796).
Sequence 
MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSS
QEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTG
LRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKI
VVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNV
IGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA
Sequence length 292
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Show/Hide Text Mining Associations (6)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 36835443
Carcinogenesis Associate 36209503
Neoplasm Metastasis Associate 36835443
Ovarian Neoplasms Inhibit 34218800
Stomach Neoplasms Inhibit 36209503
Thyroid Neoplasms Associate 32377223