FETUB (fetuin B)

Gene

• Entrez ID: 26998
• Gene name: Fetuin B
• Gene symbol: FETUB
• Synonyms (NCBI Gene): 16G2, Gugu, IRL685
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption, regulation of the i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019366	hsa-miR-148b-3p	Microarray	17612493
MIRT994881	hsa-miR-3613-3p	CLIP-seq
MIRT994882	hsa-miR-4329	CLIP-seq
MIRT994883	hsa-miR-4663	CLIP-seq
MIRT994884	hsa-miR-4728-3p	CLIP-seq
MIRT994885	hsa-miR-4786-5p	CLIP-seq
MIRT994886	hsa-miR-769-5p	CLIP-seq
MIRT1548683	hsa-miR-1281	CLIP-seq
MIRT1548683	hsa-miR-1281	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007338	Process	Single fertilization	ISS
GO:0007339	Process	Binding of sperm to zona pellucida	IBA
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	ISS
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	ISS
GO:0010951	Process	Negative regulation of endopeptidase activity	ISS
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 605954
• HGNC: 3658
• e!Ensembl: ENSG00000090512

Protein

• UniProt ID: Q9UGM5
• Protein name: Fetuin-B (16G2) (Fetuin-like protein IRL685) (Gugu)
• Protein function: Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona
• PDB: 6SAZ, 7UAI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00031	Cystatin	32 → 125	Cystatin domain	Domain
  PF00031	Cystatin	154 → 246	Cystatin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver and testis.
• Sequence:

  MGLLLPLALCILVLCCGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGY
  VLRLNRVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAI
  FYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNN
  ENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGS
  LTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGP
  RGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPK
  EKARTAECPGPAQNASPLVLPP

• Sequence length: 382