FETUB (fetuin B)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26998
Gene name Gene Name - the full gene name approved by the HGNC.
Fetuin B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FETUB
Synonyms (NCBI Gene) Gene synonyms aliases
16G2, Gugu, IRL685
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q27.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption, regulation of the i
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT019366 hsa-miR-148b-3p Microarray 17612493
MIRT994881 hsa-miR-3613-3p CLIP-seq
MIRT994882 hsa-miR-4329 CLIP-seq
MIRT994883 hsa-miR-4663 CLIP-seq
MIRT994884 hsa-miR-4728-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0004866 Function Endopeptidase inhibitor activity IBA 21873635
GO:0004869 Function Cysteine-type endopeptidase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605954 3658 ENSG00000090512
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9UGM5
Protein name Fetuin-B (16G2) (Fetuin-like protein IRL685) (Gugu)
Protein function Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona
PDB 6SAZ , 7UAI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00031 Cystatin 32 → 125 Cystatin domain Domain
PF00031 Cystatin 154 → 246 Cystatin domain Domain
Tissue specificity TISSUE SPECIFICITY: Liver and testis.
Sequence 
MGLLLPLALCILVLCCGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGY
VLRLNRVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAI
FYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNN
ENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGS
LTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGP
RGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPK
EKARTAECPGPAQNASPLVLPP
Sequence length 382
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 24768341
Atherosclerosis Associate 31527322, 32641418
Cerebral Infarction Associate 32641418
Colorectal Neoplasms Associate 32686686
Endometriosis Associate 37572646
Fatty Liver Associate 29138227
Fatty Liver Stimulate 29138227
Insulin Resistance Stimulate 29390354
Metabolic Diseases Associate 31919514
Obesity Associate 31527322