Gene Gene information from NCBI Gene database.
Entrez ID 26986
Gene name Poly(A) binding protein cytoplasmic 1
Gene symbol PABPC1
Synonyms (NCBI Gene)
PAB1PABPPABP1PABPC2PABPL1
Chromosome 8
Chromosome location 8q22.3
Summary This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3` poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitm
miRNA miRNA information provided by mirtarbase database.
365
miRTarBase ID miRNA Experiments Reference
MIRT004993 hsa-miR-125b-5p Microarray 17891175
MIRT028502 hsa-miR-30a-5p Proteomics 18668040
MIRT052261 hsa-let-7b-5p CLASH 23622248
MIRT047745 hsa-miR-10a-5p CLASH 23622248
MIRT047501 hsa-miR-10b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53
GO ID Ontology Definition Evidence Reference
GO:0000184 Process Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay IEA
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IDA 25225333
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604679 8554 ENSG00000070756
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P11940
Protein name Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1)
Protein function Binds the poly(A) tail of mRNA, including that of its own transcript, and regulates processes of mRNA metabolism such as pre-mRNA splicing and mRNA stability (PubMed:11051545, PubMed:17212783, PubMed:25480299). Its function in translational init
PDB 1CVJ , 1G9L , 1JGN , 1JH4 , 2K8G , 2RQG , 2RQH , 2X04 , 3KTP , 3KTR , 3KUI , 3KUJ , 3KUR , 3KUS , 3KUT , 3PKN , 3PTH , 4F02 , 4F25 , 4F26 , 5DX1 , 5DX8 , 5DXA , 5LGP , 5LGQ , 5LGR , 5LGS , 7BN3 , 8SMO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 13 83 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 101 168 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 193 262 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 296 364 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00658 PABP 547 614 Poly-adenylate binding protein, unique domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVR
IMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKV
FVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIY
VGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLY
VALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVL
QAHQAKEAAQKAVNSATGVPTV
Sequence length 636
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  mRNA surveillance pathway
RNA degradation
  L13a-mediated translational silencing of Ceruloplasmin expression
Deadenylation of mRNA
AUF1 (hnRNP D0) binds and destabilizes mRNA
Translation initiation complex formation
Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Pulmonary artery atresia Pathogenic rs80006036 RCV002512182
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
CIC-rearranged sarcoma not provided rs1587140774 RCV000993823
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs201406152, rs1810551569, rs2129714985, rs202060459 RCV004557859
RCV004557860
RCV004557861
RCV004557862
Teratoma Uncertain significance rs755674364 RCV003221374
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 37058032
Adenocarcinoma of Lung Associate 32087603
Alzheimer Disease Associate 40653482
Amyotrophic Lateral Sclerosis Associate 25111021
Atherosclerosis Associate 37311641
Azoospermia Associate 26843391
Carcinogenesis Associate 26097561
Carcinoma Hepatocellular Associate 33080414
Carcinoma Ovarian Epithelial Associate 36229065
Carcinoma Transitional Cell Associate 37058032