GIP (gastric inhibitory polypeptide)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2695
Gene name Gene Name - the full gene name approved by the HGNC.
Gastric inhibitory polypeptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GIP
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nu
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT018333 hsa-miR-335-5p Microarray 18185580
MIRT021426 hsa-miR-9-5p Microarray 17612493
MIRT1019349 hsa-miR-1299 CLIP-seq
MIRT1019350 hsa-miR-2117 CLIP-seq
MIRT1019351 hsa-miR-3940-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(35)
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity IEA
GO:0005515 Function Protein binding IPI 17715056, 25416956, 32296183
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0005788 Component Endoplasmic reticulum lumen TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
137240 4270 ENSG00000159224
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P09681
Protein name Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide) (Incretin hormone)
Protein function Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
PDB 1T5Q , 2B4N , 2L70 , 2L71 , 2OBU , 2QKH , 7DTY , 7RA3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00123 Hormone_2 52 → 79 Peptide hormone Family
Sequence 
MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISD
YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPA
KNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR
Sequence length 153
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Insulin secretion 		  Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 29212778
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Myocardial Infarction Myocardial Infarction GWAS
Hypertension Hypertension GWAS
Insomnia Insomnia GWAS
Show/Hide Text Mining Associations (45)
Associations from Text Mining
Disease Name Relationship Type References
Acromegaly Associate 34334589
Adrenal Gland Diseases Associate 28931750
Adrenal Hyperplasia Congenital Associate 1325608
Amyotrophic Lateral Sclerosis Associate 26198021
Attention Deficit Disorder with Hyperactivity Associate 36151371
Birth Weight Associate 21917634
Bone Diseases Associate 33852173
Carcinoma Renal Cell Inhibit 39273671
Cardiomyopathies Associate 35123462
Cardiovascular Diseases Associate 20470376, 29765988, 34426508