GIP (gastric inhibitory polypeptide)

Gene

• Entrez ID: 2695
• Gene name: Gastric inhibitory polypeptide
• Gene symbol: GIP
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q21.32
• Summary: This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018333	hsa-miR-335-5p	Microarray	18185580
MIRT021426	hsa-miR-9-5p	Microarray	17612493
MIRT1019349	hsa-miR-1299	CLIP-seq
MIRT1019350	hsa-miR-2117	CLIP-seq
MIRT1019351	hsa-miR-3940-5p	CLIP-seq
MIRT1019352	hsa-miR-4507	CLIP-seq
MIRT1019353	hsa-miR-4753-3p	CLIP-seq
MIRT1019354	hsa-miR-4778-5p	CLIP-seq
MIRT1019355	hsa-miR-4782-5p	CLIP-seq
MIRT1019356	hsa-miR-516b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	2890159
GO:0005515	Function	Protein binding	IPI	17715056, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007165	Process	Signal transduction	TAS	2890159
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	26572091
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007613	Process	Memory	IEA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0031018	Process	Endocrine pancreas development	IEA
GO:0031767	Function	Gastric inhibitory polypeptide receptor binding	IPI	17715056, 26572091
GO:0031769	Function	Glucagon receptor binding	IBA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035640	Process	Exploration behavior	IEA
GO:0038192	Process	Gastric inhibitory peptide signaling pathway	IDA	26572091
GO:0042304	Process	Regulation of fatty acid biosynthetic process	IEA
GO:0042594	Process	Response to starvation	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050796	Process	Regulation of insulin secretion	TAS	20081857

Other IDs

• MIM: 137240
• HGNC: 4270
• e!Ensembl: ENSG00000159224

Protein

• UniProt ID: P09681
• Protein name: Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide) (Incretin hormone)
• Protein function: Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
• PDB: 1T5Q, 2B4N, 2L70, 2L71, 2OBU, 2QKH, 7DTY, 7RA3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00123	Hormone_2	52 → 79	Peptide hormone	Family

• Sequence:

  MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISD
  YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPA
  KNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR

• Sequence length: 153

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Insulin secretion

Reactome:

Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production