Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2690
Gene name Gene Name - the full gene name approved by the HGNC.	Growth hormone receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GHR
Synonyms (NCBI Gene) Gene synonyms aliases	GHBP, GHIP
Disease Acronyms (UniProt) Disease acronyms from UniProt database	GHIP
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p13.1-p12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the type I cytokine receptor family, which is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal tran

Show/Hide all(34)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6177	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Coding sequence variant, missense variant
rs6180	A>C,G	Risk-factor, benign	Coding sequence variant, 3 prime UTR variant, missense variant
rs6413484	G>A,T	Benign, uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs45588036	G>C	Pathogenic	Coding sequence variant, missense variant
rs114025919	G>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs121909357	T>C	Pathogenic	Coding sequence variant, missense variant
rs121909358	C>A,G,T	Pathogenic	Synonymous variant, stop gained, coding sequence variant, missense variant
rs121909359	C>A	Pathogenic	Stop gained, coding sequence variant
rs121909360	A>G	Pathogenic	Synonymous variant, coding sequence variant
rs121909361	G>A	Pathogenic	Coding sequence variant, missense variant
rs121909362	C>T	Conflicting-interpretations-of-pathogenicity, pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs121909363	C>T	Pathogenic	Stop gained, coding sequence variant
rs121909364	G>A,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs121909365	C>A	Pathogenic	Coding sequence variant, missense variant
rs121909366	G>C	Pathogenic	Coding sequence variant, missense variant
rs121909367	T>C	Pathogenic	Coding sequence variant, missense variant
rs121909368	A>C,T	Pathogenic	Coding sequence variant, missense variant
rs121909369	T>A,G	Pathogenic	Coding sequence variant, missense variant
rs121909370	G>A,C	Pathogenic	Stop gained, coding sequence variant, intron variant, missense variant
rs121909371	C>A	Pathogenic	Stop gained, coding sequence variant
rs121909372	G>C	Pathogenic	Coding sequence variant, missense variant
rs121909373	T>C,G	Pathogenic	Synonymous variant, coding sequence variant, missense variant
rs140501920	A>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Synonymous variant, coding sequence variant
rs143814221	T>C	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs190314158	T>C,G	Pathogenic	Missense variant, coding sequence variant
rs730880281	G>T	Pathogenic	Splice acceptor variant
rs730880282	G>C	Pathogenic	Coding sequence variant, missense variant
rs730880308	G>C	Pathogenic	Splice acceptor variant, intron variant
rs886037910	T>C	Pathogenic	Coding sequence variant, missense variant
rs1060499692	G>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1554040858	G>A	Pathogenic	Coding sequence variant, synonymous variant, intron variant
rs1579626395	A>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1579636931	AGGA>GGG	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1579675001	G>A	Pathogenic	Intron variant, splice donor variant

Show/Hide all(210)

miRTarBase ID	miRNA	Experiments
MIRT1018420	hsa-miR-1261	CLIP-seq
MIRT1018421	hsa-miR-1270	CLIP-seq
MIRT1018422	hsa-miR-1276	CLIP-seq
MIRT1018423	hsa-miR-128	CLIP-seq
MIRT1018424	hsa-miR-1285	CLIP-seq
MIRT1018425	hsa-miR-1296	CLIP-seq
MIRT1018426	hsa-miR-142-3p	CLIP-seq
MIRT1018427	hsa-miR-2054	CLIP-seq
MIRT1018428	hsa-miR-2909	CLIP-seq
MIRT1018429	hsa-miR-3065-5p	CLIP-seq
MIRT1018430	hsa-miR-3120-5p	CLIP-seq
MIRT1018431	hsa-miR-3158-3p	CLIP-seq
MIRT1018432	hsa-miR-3163	CLIP-seq
MIRT1018433	hsa-miR-3187-5p	CLIP-seq
MIRT1018434	hsa-miR-3664-5p	CLIP-seq
MIRT1018435	hsa-miR-3668	CLIP-seq
MIRT1018436	hsa-miR-3689a-3p	CLIP-seq
MIRT1018437	hsa-miR-3689c	CLIP-seq
MIRT1018438	hsa-miR-3689d	CLIP-seq
MIRT1018439	hsa-miR-3924	CLIP-seq
MIRT1018440	hsa-miR-3926	CLIP-seq
MIRT1018441	hsa-miR-4280	CLIP-seq
MIRT1018442	hsa-miR-4302	CLIP-seq
MIRT1018443	hsa-miR-4311	CLIP-seq
MIRT1018444	hsa-miR-4424	CLIP-seq
MIRT1018445	hsa-miR-4433	CLIP-seq
MIRT1018446	hsa-miR-4446-3p	CLIP-seq
MIRT1018447	hsa-miR-4459	CLIP-seq
MIRT1018448	hsa-miR-4492	CLIP-seq
MIRT1018449	hsa-miR-4498	CLIP-seq
MIRT1018450	hsa-miR-4505	CLIP-seq
MIRT1018451	hsa-miR-4522	CLIP-seq
MIRT1018452	hsa-miR-4648	CLIP-seq
MIRT1018453	hsa-miR-4654	CLIP-seq
MIRT1018454	hsa-miR-4683	CLIP-seq
MIRT1018455	hsa-miR-4728-5p	CLIP-seq
MIRT1018456	hsa-miR-4768-3p	CLIP-seq
MIRT1018457	hsa-miR-4769-5p	CLIP-seq
MIRT1018458	hsa-miR-4786-5p	CLIP-seq
MIRT1018459	hsa-miR-4793-5p	CLIP-seq
MIRT1018460	hsa-miR-548aa	CLIP-seq
MIRT1018461	hsa-miR-548g	CLIP-seq
MIRT1018462	hsa-miR-548p	CLIP-seq
MIRT1018463	hsa-miR-548s	CLIP-seq
MIRT1018464	hsa-miR-564	CLIP-seq
MIRT1018465	hsa-miR-583	CLIP-seq
MIRT1018466	hsa-miR-612	CLIP-seq
MIRT1018467	hsa-miR-620	CLIP-seq
MIRT1018468	hsa-miR-649	CLIP-seq
MIRT1018469	hsa-miR-762	CLIP-seq
MIRT1018470	hsa-miR-944	CLIP-seq
MIRT1018471	hsa-let-7a	CLIP-seq
MIRT1018472	hsa-let-7b	CLIP-seq
MIRT1018473	hsa-let-7c	CLIP-seq
MIRT1018474	hsa-let-7d	CLIP-seq
MIRT1018475	hsa-let-7e	CLIP-seq
MIRT1018476	hsa-let-7f	CLIP-seq
MIRT1018477	hsa-let-7g	CLIP-seq
MIRT1018478	hsa-let-7i	CLIP-seq
MIRT1018479	hsa-miR-1252	CLIP-seq
MIRT1018480	hsa-miR-202	CLIP-seq
MIRT1018429	hsa-miR-3065-5p	CLIP-seq
MIRT1018430	hsa-miR-3120-5p	CLIP-seq
MIRT1018481	hsa-miR-3150a-3p	CLIP-seq
MIRT1018482	hsa-miR-3175	CLIP-seq
MIRT1018434	hsa-miR-3664-5p	CLIP-seq
MIRT1018483	hsa-miR-3672	CLIP-seq
MIRT1018484	hsa-miR-3929	CLIP-seq
MIRT1018485	hsa-miR-4294	CLIP-seq
MIRT1018486	hsa-miR-4419b	CLIP-seq
MIRT1018487	hsa-miR-4458	CLIP-seq
MIRT1018488	hsa-miR-4478	CLIP-seq
MIRT1018489	hsa-miR-4499	CLIP-seq
MIRT1018490	hsa-miR-4500	CLIP-seq
MIRT1018451	hsa-miR-4522	CLIP-seq
MIRT1018491	hsa-miR-4667-5p	CLIP-seq
MIRT1018492	hsa-miR-4678	CLIP-seq
MIRT1018493	hsa-miR-4700-5p	CLIP-seq
MIRT1018494	hsa-miR-494	CLIP-seq
MIRT1018495	hsa-miR-548ae	CLIP-seq
MIRT1018496	hsa-miR-548aj	CLIP-seq
MIRT1018497	hsa-miR-548am	CLIP-seq
MIRT1018498	hsa-miR-548x	CLIP-seq
MIRT1018499	hsa-miR-637	CLIP-seq
MIRT1018500	hsa-miR-653	CLIP-seq
MIRT1018501	hsa-miR-939	CLIP-seq
MIRT1018502	hsa-miR-98	CLIP-seq
MIRT2001622	hsa-miR-1271	CLIP-seq
MIRT2001623	hsa-miR-129-5p	CLIP-seq
MIRT2001624	hsa-miR-182	CLIP-seq
MIRT2001625	hsa-miR-1827	CLIP-seq
MIRT2001626	hsa-miR-3622a-5p	CLIP-seq
MIRT2001627	hsa-miR-3664-3p	CLIP-seq
MIRT1018436	hsa-miR-3689a-3p	CLIP-seq
MIRT1018437	hsa-miR-3689c	CLIP-seq
MIRT1018484	hsa-miR-3929	CLIP-seq
MIRT1018486	hsa-miR-4419b	CLIP-seq
MIRT1018445	hsa-miR-4433	CLIP-seq
MIRT1018447	hsa-miR-4459	CLIP-seq
MIRT1018488	hsa-miR-4478	CLIP-seq
MIRT2001628	hsa-miR-4642	CLIP-seq
MIRT2001629	hsa-miR-4649-3p	CLIP-seq
MIRT2001630	hsa-miR-4681	CLIP-seq
MIRT1018454	hsa-miR-4683	CLIP-seq
MIRT2001631	hsa-miR-4695-5p	CLIP-seq
MIRT1018455	hsa-miR-4728-5p	CLIP-seq
MIRT1018456	hsa-miR-4768-3p	CLIP-seq
MIRT2001632	hsa-miR-485-5p	CLIP-seq
MIRT2001633	hsa-miR-510	CLIP-seq
MIRT2001634	hsa-miR-512-5p	CLIP-seq
MIRT1018464	hsa-miR-564	CLIP-seq
MIRT2001635	hsa-miR-96	CLIP-seq
MIRT1018421	hsa-miR-1270	CLIP-seq
MIRT2234677	hsa-miR-15a	CLIP-seq
MIRT2234678	hsa-miR-15b	CLIP-seq
MIRT2234679	hsa-miR-16	CLIP-seq
MIRT2234680	hsa-miR-195	CLIP-seq
MIRT1018480	hsa-miR-202	CLIP-seq
MIRT2234681	hsa-miR-2276	CLIP-seq
MIRT2234682	hsa-miR-25	CLIP-seq
MIRT1018429	hsa-miR-3065-5p	CLIP-seq
MIRT2234683	hsa-miR-3074-5p	CLIP-seq
MIRT1018430	hsa-miR-3120-5p	CLIP-seq
MIRT2234684	hsa-miR-3123	CLIP-seq
MIRT2234685	hsa-miR-32	CLIP-seq
MIRT2234686	hsa-miR-3200-5p	CLIP-seq
MIRT2234687	hsa-miR-3613-3p	CLIP-seq
MIRT2234688	hsa-miR-363	CLIP-seq
MIRT1018434	hsa-miR-3664-5p	CLIP-seq
MIRT2234689	hsa-miR-3667-3p	CLIP-seq
MIRT1018435	hsa-miR-3668	CLIP-seq
MIRT2234690	hsa-miR-367	CLIP-seq
MIRT2234691	hsa-miR-3920	CLIP-seq
MIRT1018439	hsa-miR-3924	CLIP-seq
MIRT1018440	hsa-miR-3926	CLIP-seq
MIRT2234692	hsa-miR-424	CLIP-seq
MIRT2234693	hsa-miR-432	CLIP-seq
MIRT1018445	hsa-miR-4433	CLIP-seq
MIRT2234694	hsa-miR-4434	CLIP-seq
MIRT1018447	hsa-miR-4459	CLIP-seq
MIRT2234695	hsa-miR-4516	CLIP-seq
MIRT1018451	hsa-miR-4522	CLIP-seq
MIRT2234696	hsa-miR-4524	CLIP-seq
MIRT2234697	hsa-miR-4531	CLIP-seq
MIRT2234698	hsa-miR-4540	CLIP-seq
MIRT1018454	hsa-miR-4683	CLIP-seq
MIRT2234699	hsa-miR-4696	CLIP-seq
MIRT2234700	hsa-miR-4699-3p	CLIP-seq
MIRT1018456	hsa-miR-4768-3p	CLIP-seq
MIRT1018458	hsa-miR-4786-5p	CLIP-seq
MIRT1018459	hsa-miR-4793-5p	CLIP-seq
MIRT2234701	hsa-miR-497	CLIP-seq
MIRT2234702	hsa-miR-503	CLIP-seq
MIRT1018460	hsa-miR-548aa	CLIP-seq
MIRT1018463	hsa-miR-548s	CLIP-seq
MIRT2234703	hsa-miR-593	CLIP-seq
MIRT1018467	hsa-miR-620	CLIP-seq
MIRT2234704	hsa-miR-646	CLIP-seq
MIRT2234705	hsa-miR-92a	CLIP-seq
MIRT2234706	hsa-miR-92b	CLIP-seq
MIRT1018430	hsa-miR-3120-5p	CLIP-seq
MIRT2388442	hsa-miR-3182	CLIP-seq
MIRT2388443	hsa-miR-4659a-3p	CLIP-seq
MIRT2388444	hsa-miR-4659b-3p	CLIP-seq
MIRT2388445	hsa-miR-4796-5p	CLIP-seq
MIRT2388442	hsa-miR-3182	CLIP-seq
MIRT2437409	hsa-miR-4327	CLIP-seq
MIRT2437410	hsa-miR-4427	CLIP-seq
MIRT2388443	hsa-miR-4659a-3p	CLIP-seq
MIRT2388444	hsa-miR-4659b-3p	CLIP-seq
MIRT2437411	hsa-miR-4680-3p	CLIP-seq
MIRT1018429	hsa-miR-3065-5p	CLIP-seq
MIRT1018430	hsa-miR-3120-5p	CLIP-seq
MIRT2538694	hsa-miR-3155	CLIP-seq
MIRT2538695	hsa-miR-3155b	CLIP-seq
MIRT2538696	hsa-miR-3611	CLIP-seq
MIRT2234687	hsa-miR-3613-3p	CLIP-seq
MIRT1018434	hsa-miR-3664-5p	CLIP-seq
MIRT2538697	hsa-miR-409-3p	CLIP-seq
MIRT1018451	hsa-miR-4522	CLIP-seq
MIRT2538698	hsa-miR-4687-3p	CLIP-seq
MIRT2538699	hsa-miR-4785	CLIP-seq
MIRT2538700	hsa-miR-484	CLIP-seq
MIRT2234703	hsa-miR-593	CLIP-seq
MIRT1018429	hsa-miR-3065-5p	CLIP-seq
MIRT1018430	hsa-miR-3120-5p	CLIP-seq
MIRT2681562	hsa-miR-3122	CLIP-seq
MIRT2538694	hsa-miR-3155	CLIP-seq
MIRT2538695	hsa-miR-3155b	CLIP-seq
MIRT2681563	hsa-miR-3165	CLIP-seq
MIRT2388442	hsa-miR-3182	CLIP-seq
MIRT2538696	hsa-miR-3611	CLIP-seq
MIRT2234687	hsa-miR-3613-3p	CLIP-seq
MIRT1018434	hsa-miR-3664-5p	CLIP-seq
MIRT1018436	hsa-miR-3689a-3p	CLIP-seq
MIRT1018437	hsa-miR-3689c	CLIP-seq
MIRT2681564	hsa-miR-3913-5p	CLIP-seq
MIRT2538697	hsa-miR-409-3p	CLIP-seq
MIRT2437409	hsa-miR-4327	CLIP-seq
MIRT2437410	hsa-miR-4427	CLIP-seq
MIRT1018451	hsa-miR-4522	CLIP-seq
MIRT2388443	hsa-miR-4659a-3p	CLIP-seq
MIRT2388444	hsa-miR-4659b-3p	CLIP-seq
MIRT2437411	hsa-miR-4680-3p	CLIP-seq
MIRT2538698	hsa-miR-4687-3p	CLIP-seq
MIRT1018455	hsa-miR-4728-5p	CLIP-seq
MIRT2538699	hsa-miR-4785	CLIP-seq
MIRT1018458	hsa-miR-4786-5p	CLIP-seq
MIRT2538700	hsa-miR-484	CLIP-seq
MIRT2234703	hsa-miR-593	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
POU1F1	Activation	7529501

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	ISS
GO:0004896	Function	Cytokine receptor activity	IBA	21873635
GO:0004903	Function	Growth hormone receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8943276, 9353194, 10502458, 10866662, 12907755, 17474147, 19167335, 25241761, 31279174
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	8137822
GO:0005615	Component	Extracellular space	IMP	2825030
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	8137822
GO:0006897	Process	Endocytosis	IEA
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	ISS
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009986	Component	Cell surface	IDA	8137822
GO:0016021	Component	Integral component of membrane	IDA	1549776
GO:0017046	Function	Peptide hormone binding	IBA	21873635
GO:0017046	Function	Peptide hormone binding	IPI	1549776, 2825030, 8943276, 9571026
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019530	Process	Taurine metabolic process	ISS
GO:0019838	Function	Growth factor binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	ISS
GO:0019955	Function	Cytokine binding	IBA	21873635
GO:0032870	Process	Cellular response to hormone stimulus	IMP	7565946
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0040014	Process	Regulation of multicellular organism growth	ISS
GO:0040018	Process	Positive regulation of multicellular organism growth	IMP	2813379
GO:0042445	Process	Hormone metabolic process	IMP	8137822
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	ISS	2825030
GO:0042802	Function	Identical protein binding	IPI	16116438
GO:0042803	Function	Protein homodimerization activity	IDA	1549776, 8137822, 8943276
GO:0042976	Process	Activation of Janus kinase activity	ISS
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043235	Component	Receptor complex	IDA	8137822
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IMP	7565946
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IBA	21873635
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	ISS
GO:0060396	Process	Growth hormone receptor signaling pathway	IBA	21873635
GO:0060396	Process	Growth hormone receptor signaling pathway	IMP	7565946
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	TAS
GO:0070064	Function	Proline-rich region binding	ISS	2825030
GO:0070195	Component	Growth hormone receptor complex	IBA	21873635
GO:0070195	Component	Growth hormone receptor complex	IDA	1549776, 8137822, 8943276, 9571026

MIM	HGNC	e!Ensembl
600946	4263	ENSG00000112964

Protein

UniProt ID

P10912

Protein name

Growth hormone receptor (GH receptor) (Somatotropin receptor) [Cleaved into: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)]

Protein function

Receptor for pituitary gland growth hormone (GH1) involved in regulating postnatal body growth (PubMed:1549776, PubMed:2825030, PubMed:8943276). On ligand binding, couples to the JAK2/STAT5 pathway (PubMed:1549776, PubMed:15690087, PubMed:282503

PDB

1A22 , 1AXI , 1HWG , 1HWH , 1KF9 , 2AEW , 3HHR , 5OEK , 5OHD , 6I5J , 6I5N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09067	EpoR_lig-bind	43 → 144	Erythropoietin receptor, ligand binding	Domain
PF00041	fn3	159 → 244	Fibronectin type III domain	Domain
PF12772	GHBP	316 → 617	Growth hormone receptor binding	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in various tissues with high expression in liver and skeletal muscle. {ECO:0000269|PubMed:8855247}.; TISSUE SPECIFICITY: [Isoform 2]: Isoform 2 is expressed in lung, stomach and muscle. {ECO:0000269|PubMed:8855247}.; TISSUE S

Sequence

MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEES
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LSNIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADA
KKCIPVAPHIKVESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP

Sequence length

638

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Neuroactive ligand-receptor interaction Hormone signaling PI3K-Akt signaling pathway JAK-STAT signaling pathway Growth hormone synthesis, secretion and action		Prolactin receptor signaling Growth hormone receptor signaling

Show/Hide Causal Diseases (10)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	17547689
Brachydactyly	Brachydactyly	rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852 View all (22 more)
Hypercholesterolemia	Hypercholesterolemia	rs28942111, rs28942112, rs137852912, rs121908025, rs28942082, rs28942083, rs121908028, rs121908030, rs28942079, rs28942084, rs121908032, rs387906302, rs387906303, rs121908033, rs121908034 View all (1161 more)
Hyperlipoproteinemia	Hyperlipoproteinemia Type IIa	rs118204056, rs118204057, rs118204058, rs118204059, rs1563572716, rs118204060, rs118204067, rs118204062, rs118204074, rs118204063, rs118204064, rs1563569634, rs118204065, rs118204066, rs1563575252 View all (36 more)
Isolated somatotropin deficiency	Isolated somatotropin deficiency	rs797044450, rs71640277, rs863223306, rs2144738731, rs863223307, rs2144739370, rs863223309, rs863223310, rs137853223, rs2144739380, rs2144739391
Laron syndrome	Laron Syndrome, Laron syndrome	rs730880282, rs121909364, rs1579675001, rs121909365	8488849, 8137822, 18406284, 10870033, 14678285, 1999489, 9024232, 8504296, 9467570, 24664892, 8450064, 2779634, 9851797, 9661642
Macrocephaly	Relative macrocephaly	rs786204854, rs764333096, rs1557739557
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17220348

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Evidence	Source
Unknown
Specific learning disorder	Specific learning disability		ClinVar
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS
Lung adenocarcinoma	Lung adenocarcinoma	Validation that loss of Tgfbr2 results in more aggressive and T cell-excluded KP lung tumors	GWAS, CBGDA
Atrial Fibrillation	Atrial Fibrillation		GWAS

Show/Hide Text Mining Associations (87)

Disease Name	Relationship Type	References
Associations from Text Mining
Acromegaly	Associate	23648743, 39280003
Adenocarcinoma	Associate	24608110
Adenocarcinoma of Lung	Associate	23111975, 34590916
alpha Mannosidosis	Associate	34614013
Arteriovenous Malformations	Associate	37864259
Astrocytoma	Associate	10890179
Barrett Esophagus	Associate	33300568
Brain Neoplasms	Associate	10890179
Breast Neoplasms	Associate	11290538, 23192981, 24676793
Burkitt Lymphoma	Associate	23047741
Carcinogenesis	Associate	24134847
Carcinoma Basal Cell	Associate	24022308
Carcinoma Hepatocellular	Inhibit	33317258, 36374927
Carcinoma Non Small Cell Lung	Associate	39541775
Carcinoma Pancreatic Ductal	Associate	25301264
Cognition Disorders	Associate	28073935, 34614013
Congenital Abnormalities	Associate	20190552, 37806643
Craniopharyngioma	Associate	10890179
Cysts	Associate	18202196
Death	Associate	21325617
Dental Caries	Associate	15869869
Dermatomyositis	Associate	30352204
Diabetes Gestational	Associate	17555507
Diabetes Mellitus Type 2	Associate	31869513, 32928870, 36357677, 38623619
Dwarfism	Associate	28557176, 34769292
Dwarfism Pituitary	Associate	26261638, 29687007, 7565946
Esophageal Neoplasms	Associate	32869542
Fibrosis	Inhibit	33317258
Fragile X Syndrome	Associate	39280003
Frailty	Associate	37697678, 39464190
Gastritis Atrophic	Associate	15334699
Gastrointestinal Neoplasms	Associate	24608110
Genetic Diseases Inborn	Associate	1999489
Glioblastoma	Associate	35808822
Glucose Intolerance	Associate	36357677
Growth Disorders	Associate	17555507, 20013551, 23047741, 24150201, 26261638, 26366551, 29687007, 31883394, 37474955, 38597155, 9276733
Hemochromatosis	Associate	17555507, 26340968
Hypertension	Associate	34074802, 37561089
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	36374927
Insulin Like Growth Factor I Deficiency	Inhibit	21325617
Insulin Like Growth Factor I Deficiency	Associate	34769292
Laron Syndrome	Associate	11468686, 15473594, 1719554, 17622584, 19812236, 1999489, 20190552, 20427506, 2233903, 26366551, 2813379, 28557176, 31883394, 33912130, 34769292 View all (6 more)
Laron Syndrome	Inhibit	21325617
Laron Syndrome	Stimulate	31883394
Leigh Disease	Associate	36549505
Leukoencephalopathies	Associate	28401151
Lung Neoplasms	Associate	16741161, 39541775
Lymphatic Metastasis	Stimulate	24676793
Malocclusion Angle Class III	Associate	24654940
Melanoma	Associate	24134847, 28223541
Melanoma	Stimulate	28293855
Meningioma	Associate	12163391
Neoplasm Metastasis	Associate	25301264
Neoplasms	Associate	10890179, 23129384, 24022308, 24134847, 24676793, 25119594, 25301264, 28223541, 33317258
Neoplasms	Stimulate	35808822
Neoplasms Adipose Tissue	Associate	36384443
Neoplastic Syndromes Hereditary	Associate	1999489
Neurofibroma	Associate	18297205
Neurofibroma Plexiform	Associate	18297205
Neurofibromatosis 1	Associate	18297205
Non alcoholic Fatty Liver Disease	Associate	35780715
Obesity	Associate	34769292, 39464190
Obesity	Stimulate	36384443
Osteosarcoma	Associate	23129384
Overweight	Stimulate	36384443
Pancreatic Neoplasms	Associate	25301264
Peri Implantitis	Associate	40004451
Pituitary ACTH Hypersecretion	Associate	20013551
Prader Willi Syndrome	Associate	23696513, 29273483
Primary Ovarian Insufficiency	Associate	32962729
Pulmonary Arterial Hypertension	Associate	35960497
Renal Insufficiency	Associate	31883394
Sarcopenia	Associate	18240972
Schizophrenia	Associate	21518920, 27723806, 28401151
Schwartz Lelek syndrome	Associate	9382103
Scoliosis	Associate	29273483
Short Stature Idiopathic Autosomal	Associate	20427506, 24150201, 26261638, 28557176, 28768959, 7565946
Spondylocostal dysostosis autosomal recessive	Associate	39280003
Stomach Neoplasms	Associate	30702489, 35299682
Stomach Neoplasms	Stimulate	30873760
Thyroid Hormone Resistance Syndrome	Associate	8381821
Thyroid Neoplasms	Associate	32849296
Thyroid Nodule	Associate	28791847
Turner Syndrome	Associate	22278433
Urinary Bladder Neoplasms	Associate	35909123
Uterine Cervical Neoplasms	Associate	18832799
Weight Gain	Associate	29273483

GHR (growth hormone receptor)