Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2676
Gene name Gene Name - the full gene name approved by the HGNC.	GDNF family receptor alpha 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GFRA3
Synonyms (NCBI Gene) Gene synonyms aliases	GDNFR3
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q31.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin. [provided

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT731397	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28356515
MIRT2234439	hsa-miR-1270	CLIP-seq
MIRT2234440	hsa-miR-1273f	CLIP-seq
MIRT2234441	hsa-miR-224	CLIP-seq
MIRT2234442	hsa-miR-342-5p	CLIP-seq
MIRT2234443	hsa-miR-4651	CLIP-seq
MIRT2234444	hsa-miR-4664-5p	CLIP-seq
MIRT2234445	hsa-miR-4683	CLIP-seq
MIRT2234446	hsa-miR-4795-5p	CLIP-seq
MIRT2234447	hsa-miR-608	CLIP-seq
MIRT2234448	hsa-miR-620	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001764	Process	Neuron migration	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9407096
GO:0005515	Function	Protein binding	IPI	16765900
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	TAS	9490034, 9576965
GO:0007399	Process	Nervous system development	IBA	21873635
GO:0007411	Process	Axon guidance	TAS
GO:0007422	Process	Peripheral nervous system development	TAS	9576965
GO:0008046	Function	Axon guidance receptor activity	IEA
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0016167	Function	Glial cell-derived neurotrophic factor receptor activity	IBA	21873635
GO:0019898	Component	Extrinsic component of membrane	TAS	9490034
GO:0031225	Component	Anchored component of membrane	IEA
GO:0035860	Process	Glial cell-derived neurotrophic factor receptor signaling pathway	IEA
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0048485	Process	Sympathetic nervous system development	IEA

MIM	HGNC	e!Ensembl
605710	4245	ENSG00000146013

Protein

UniProt ID

O60609

Protein name

GDNF family receptor alpha-3 (GDNF receptor alpha-3) (GDNFR-alpha-3) (GFR-alpha-3)

Protein function

Receptor for artemin (ARTN), a growth factor that supports the survival of sensory and sympathetic peripheral neurons (PubMed:31535977, PubMed:9883723). ARTN-binding leads to autophosphorylation and activation of the RET receptor (PubMed:3153597

PDB

2GH0 , 6Q2S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02351	GDNF	44 → 125	GDNF/GAS1 domain	Domain
PF02351	GDNF	162 → 239	GDNF/GAS1 domain	Domain
PF02351	GDNF	248 → 340	GDNF/GAS1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in adult and fetus which exhibit a similar pattern. Essentially not expressed in the central nervous system, but highly expressed in several sensory and sympathetic ganglia of the peripheral nervous system. Moderate ex

Sequence

MVRPLNPRPLPPVVLMLLLLLPPSPLPLAAGDPLPTESRLMNSCLQARRKCQADPTCSAA
YHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTV
HRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRK
AYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCA
LPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAM
TPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDW
PHPTFAVMAHQNENPAVRPQPWVPSLFSCTLPLILLLSLW

Sequence length

400

Interactions

View interactions

	Reactome
			RAF/MAP kinase cascade RET signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	20116071

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Eczema	Eczema	GWAS
Alzheimer disease	Alzheimer disease	GWAS

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	36353226
Breast Neoplasms	Stimulate	23351331
Breast Neoplasms	Associate	28356515, 32526247
Carcinoma Pancreatic Ductal	Associate	16858191
Hirschsprung Disease	Associate	10978357
Liposarcoma Myxoid	Associate	20522586
Lymphatic Metastasis	Stimulate	23351331
Neoplasms	Associate	16858191, 26984265, 32526247, 33128255
Pancreatic Neoplasms	Associate	22901124
Pancreatitis Chronic	Associate	17047099
Stomach Neoplasms	Associate	26984265
Thyroiditis Autoimmune	Inhibit	33600668

GFRA3 (GDNF family receptor alpha 3)