DAOA (D-amino acid oxidase activator)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 267012
Gene name D-amino acid oxidase activator
Gene symbol DAOA
Synonyms (NCBI Gene)
LG72SG72
Chromosome 13
Chromosome location 13q33.2|13q34
Summary This gene encodes a protein that may function as an activator of D-amino acid oxidase, which degrades the gliotransmitter D-serine, a potent activator of N-methyl-D-aspartate (NMDA) type glutamate receptors. Studies also suggest that one encoded isoform m
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 12364586, 20521334, 21679769, 37805834
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IDA 17684499, 21679769
GO:0005739 Component Mitochondrion IEA
GO:0005794 Component Golgi apparatus IDA 12364586
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
607408 21191 ENSG00000182346
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P59103
Protein name D-amino acid oxidase regulator (Protein G72)
Protein function May suppress DAO (D-amino acid oxidase) and SOD1 activity and promote their degradation (PubMed:18544534, PubMed:20521334, PubMed:21679769, PubMed:30037290). Has conversely also been suggested to function as a DAO activator (PubMed:12364586, Pub
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15199 DAOA 72 → 153 D-amino acid oxidase activator Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the amygdala and in astrocytes of the cortex (at protein level) (PubMed:12364586, PubMed:17684499, PubMed:18544534). Expressed in the caudate nucleus, spinal cord and testis (PubMed:12364586). {ECO:0000269|PubMed:12364586,
Sequence 
MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEG
WKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASK
DRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE
Sequence length 153
Interactions View interactions