DAOA (D-amino acid oxidase activator)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
267012
Gene name Gene Name - the full gene name approved by the HGNC.
D-amino acid oxidase activator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DAOA
Synonyms (NCBI Gene) Gene synonyms aliases
LG72, SG72
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q33.2|13q34
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that may function as an activator of D-amino acid oxidase, which degrades the gliotransmitter D-serine, a potent activator of N-methyl-D-aspartate (NMDA) type glutamate receptors. Studies also suggest that one encoded isoform m
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IDA 21679769
GO:0005794 Component Golgi apparatus IDA 12364586
GO:0008047 Function Enzyme activator activity IDA 12364586
GO:0019899 Function Enzyme binding IPI 12364586, 20521334, 21679769
GO:0043085 Process Positive regulation of catalytic activity IDA 12364586
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607408 21191 ENSG00000182346
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID P59103
Protein name D-amino acid oxidase regulator (Protein G72)
Protein function May suppress DAO (D-amino acid oxidase) and SOD1 activity and promote their degradation (PubMed:18544534, PubMed:20521334, PubMed:21679769, PubMed:30037290). Has conversely also been suggested to function as a DAO activator (PubMed:12364586, Pub
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15199 DAOA 72 → 153 D-amino acid oxidase activator Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the amygdala and in astrocytes of the cortex (at protein level) (PubMed:12364586, PubMed:17684499, PubMed:18544534). Expressed in the caudate nucleus, spinal cord and testis (PubMed:12364586). {ECO:0000269|PubMed:12364586,
Sequence 
MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEG
WKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASK
DRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE
Sequence length 153
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder 20667145, 19708722, 24447945, 21438144, 22851402, 20336655, 25043320, 22429365 ClinVar
Diabetes Diabetes GWAS
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Show/Hide Text Mining Associations (14)
Associations from Text Mining
Disease Name Relationship Type References
Affective Disorders Psychotic Associate 20667145
Alzheimer Disease Associate 26949549
Bipolar Disorder Associate 15057823, 18466879, 19194963, 20336655, 20667145, 21391259, 22438288, 23861766
Cognition Disorders Associate 19778423
Delusional Parasitosis Associate 26949549
Depressive Disorder Associate 20667145, 26949549
Depressive Disorder Major Associate 20336655
Hallucinations Associate 26949549
Mental Disorders Associate 19778423, 20336655, 20667145, 23861766, 26949549
Neurobehavioral Manifestations Associate 23861766