Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2670
Gene name Gene Name - the full gene name approved by the HGNC.	Glial fibrillary acidic protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GFAP
Synonyms (NCBI Gene) Gene synonyms aliases	ALXDRD
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ALXDRD
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocyt

Show/Hide all(97)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28932769	A>G	Pathogenic, not-provided	Missense variant, coding sequence variant
rs56679084	C>G	Uncertain-significance, pathogenic, not-provided	Missense variant, coding sequence variant
rs57120761	G>A,C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs57590980	T>C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs57661783	C>A,T	Pathogenic, not-provided	Stop gained, missense variant, coding sequence variant
rs57815192	T>A,C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs58008462	A>G	Pathogenic, not-provided	Missense variant, coding sequence variant
rs58064122	G>A,C	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs58075601	C>G,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs58536923	T>C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs58645997	C>G,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs58732244	T>A	Pathogenic, not-provided	Missense variant, coding sequence variant
rs59285727	C>A,G,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs59565950	C>A,G,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs59568967	A>G	Pathogenic, not-provided	Missense variant, coding sequence variant
rs59628143	T>C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs59661476	A>G	Pathogenic, not-provided	Missense variant, coding sequence variant
rs59793293	G>A,C,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs59985777	A>G	Pathogenic, not-provided	Missense variant, coding sequence variant
rs60095124	T>G	Pathogenic, not-provided	Missense variant, coding sequence variant
rs60269890	A>G	Pathogenic, not-provided	Missense variant, coding sequence variant
rs60343255	G>A	Pathogenic, not-provided	Missense variant, coding sequence variant
rs60449251	A>C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs60551555	A>C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs60825166	G>C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs61060395	A>C,G,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs61497286	G>A	Pathogenic, not-provided	Missense variant, coding sequence variant
rs61622935	G>A,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs61726468	C>G,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs61726470	G>C	Pathogenic, not-provided	Missense variant, coding sequence variant
rs61726471	T>A,C	Pathogenic	Missense variant, coding sequence variant
rs62635764	C>A	Pathogenic, not-provided	Downstream transcript variant, genic downstream transcript variant, missense variant, coding sequence variant
rs62636501	T>A	Pathogenic, not-provided	Missense variant, coding sequence variant
rs112611995	G>C	Pathogenic	Intron variant
rs121909717	G>A,C,T	Pathogenic, not-provided	Genic downstream transcript variant, downstream transcript variant, synonymous variant, coding sequence variant, missense variant
rs121909718	C>G	Pathogenic, not-provided	Coding sequence variant, missense variant
rs121909719	C>A	Pathogenic, not-provided	Coding sequence variant, missense variant
rs121909720	G>T	Pathogenic	Coding sequence variant, missense variant
rs267607500	C>G,T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607501	CCTT>ACTC	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607502	T>C	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607503	G>A	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607504	A>G	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607505	T>C	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607506	A>G,T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607507	C>G,T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607508	G>A,T	Not-provided, pathogenic	Genic downstream transcript variant, coding sequence variant, downstream transcript variant, missense variant
rs267607509	C>T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607510	C>T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs267607511	A>G	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607512	G>A,C	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607513	G>C	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607514	C>T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607515	A>G,T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607516	A>G	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607517	G>A,T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607518	C>A,G,T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607519	A>G	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607520	T>G	Not-provided, pathogenic	Genic downstream transcript variant, coding sequence variant, downstream transcript variant, missense variant
rs267607521	T>A	Not-provided, pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs267607523	C>T	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607525	T>G	Not-provided, pathogenic	Coding sequence variant, missense variant
rs267607526	C>G	Not-provided, pathogenic	Coding sequence variant, missense variant
rs571151302	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant, synonymous variant
rs748860341	C>G,T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant, 3 prime UTR variant, intron variant
rs775524073	G>A,T	Likely-pathogenic	3 prime UTR variant, intron variant, synonymous variant, coding sequence variant
rs797044569	C>G,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs797044570	C>T	Pathogenic	Missense variant, coding sequence variant
rs797044571	C>T	Pathogenic	Missense variant, coding sequence variant
rs797044572	A>G	Pathogenic	Missense variant, coding sequence variant
rs797044573	T>C	Pathogenic	Missense variant, coding sequence variant
rs797044574	T>G	Pathogenic	Missense variant, coding sequence variant
rs797044575	->GCCGCAGCT	Pathogenic	Inframe insertion, coding sequence variant
rs797044576	->CGCAGC	Pathogenic	Inframe insertion, coding sequence variant
rs797044577	A>T	Pathogenic	Missense variant, coding sequence variant
rs797044578	G>A	Pathogenic	Missense variant, coding sequence variant
rs797044579	A>G	Pathogenic	Missense variant, coding sequence variant
rs797044580	CA>AG	Pathogenic	Missense variant, coding sequence variant
rs797044581	C>G	Pathogenic	Missense variant, coding sequence variant
rs797044582	G>T	Pathogenic	Missense variant, coding sequence variant
rs797044583	G>C	Pathogenic	Missense variant, coding sequence variant
rs797044584	->CAAGTG	Pathogenic	Inframe insertion, coding sequence variant
rs797044585	C>G	Pathogenic	Missense variant, coding sequence variant
rs797044586	G>A	Pathogenic	Missense variant, coding sequence variant
rs797044587	G>C	Pathogenic	Coding sequence variant, synonymous variant
rs797044588	T>C	Pathogenic	Missense variant, coding sequence variant
rs797044589	T>G	Pathogenic	Missense variant, coding sequence variant
rs797044590	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs797044591	C>-	Pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant, downstream transcript variant
rs797044592	CAGCTAAC>GAT	Pathogenic	Frameshift variant, terminator codon variant, splice donor variant, 3 prime UTR variant, intron variant
rs1057518685	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057518828	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1555573462	T>A	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, downstream transcript variant, missense variant
rs1555574517	T>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1567773470	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1597853099	G>A	Likely-pathogenic	Missense variant, downstream transcript variant, coding sequence variant, genic downstream transcript variant
rs1597864461	G>T	Pathogenic	Missense variant, coding sequence variant

Show/Hide all(95)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016984	hsa-miR-335-5p	Microarray	18185580
MIRT733242	hsa-miR-146a-3p	Immunocytochemistry (ICC), Mass spectrometry, qRT-PCR, Western blotting	33968923
MIRT733607	hsa-miR-140-5p	Immunofluorescence, qRT-PCR, Western blotting	33987369
MIRT1016542	hsa-miR-1197	CLIP-seq
MIRT1016543	hsa-miR-1207-5p	CLIP-seq
MIRT1016544	hsa-miR-1285	CLIP-seq
MIRT1016545	hsa-miR-15a	CLIP-seq
MIRT1016546	hsa-miR-15b	CLIP-seq
MIRT1016547	hsa-miR-16	CLIP-seq
MIRT1016548	hsa-miR-195	CLIP-seq
MIRT1016549	hsa-miR-214	CLIP-seq
MIRT1016550	hsa-miR-3153	CLIP-seq
MIRT1016551	hsa-miR-3160-3p	CLIP-seq
MIRT1016552	hsa-miR-3162-5p	CLIP-seq
MIRT1016553	hsa-miR-3187-5p	CLIP-seq
MIRT1016554	hsa-miR-3619-5p	CLIP-seq
MIRT1016555	hsa-miR-3622b-5p	CLIP-seq
MIRT1016556	hsa-miR-3665	CLIP-seq
MIRT1016557	hsa-miR-3921	CLIP-seq
MIRT1016558	hsa-miR-3925-5p	CLIP-seq
MIRT1016559	hsa-miR-3945	CLIP-seq
MIRT1016560	hsa-miR-424	CLIP-seq
MIRT1016561	hsa-miR-4253	CLIP-seq
MIRT1016562	hsa-miR-4270	CLIP-seq
MIRT1016563	hsa-miR-4303	CLIP-seq
MIRT1016564	hsa-miR-4441	CLIP-seq
MIRT1016565	hsa-miR-4487	CLIP-seq
MIRT1016566	hsa-miR-4491	CLIP-seq
MIRT1016567	hsa-miR-4524	CLIP-seq
MIRT1016568	hsa-miR-4653-5p	CLIP-seq
MIRT1016569	hsa-miR-4657	CLIP-seq
MIRT1016570	hsa-miR-4668-5p	CLIP-seq
MIRT1016571	hsa-miR-4736	CLIP-seq
MIRT1016572	hsa-miR-4763-3p	CLIP-seq
MIRT1016573	hsa-miR-4764-5p	CLIP-seq
MIRT1016574	hsa-miR-497	CLIP-seq
MIRT1016575	hsa-miR-503	CLIP-seq
MIRT1016576	hsa-miR-558	CLIP-seq
MIRT1016577	hsa-miR-589	CLIP-seq
MIRT1016578	hsa-miR-612	CLIP-seq
MIRT1016579	hsa-miR-646	CLIP-seq
MIRT1016580	hsa-miR-761	CLIP-seq
MIRT2000900	hsa-miR-1224-3p	CLIP-seq
MIRT2000901	hsa-miR-1260	CLIP-seq
MIRT2000902	hsa-miR-1260b	CLIP-seq
MIRT2000903	hsa-miR-1280	CLIP-seq
MIRT1016545	hsa-miR-15a	CLIP-seq
MIRT1016546	hsa-miR-15b	CLIP-seq
MIRT1016547	hsa-miR-16	CLIP-seq
MIRT1016548	hsa-miR-195	CLIP-seq
MIRT1016549	hsa-miR-214	CLIP-seq
MIRT1016554	hsa-miR-3619-5p	CLIP-seq
MIRT1016560	hsa-miR-424	CLIP-seq
MIRT1016567	hsa-miR-4524	CLIP-seq
MIRT2000904	hsa-miR-4645-5p	CLIP-seq
MIRT2000905	hsa-miR-4673	CLIP-seq
MIRT2000906	hsa-miR-4699-5p	CLIP-seq
MIRT1016574	hsa-miR-497	CLIP-seq
MIRT1016575	hsa-miR-503	CLIP-seq
MIRT1016579	hsa-miR-646	CLIP-seq
MIRT1016580	hsa-miR-761	CLIP-seq
MIRT1016551	hsa-miR-3160-3p	CLIP-seq
MIRT1016565	hsa-miR-4487	CLIP-seq
MIRT2234320	hsa-miR-4663	CLIP-seq
MIRT1016576	hsa-miR-558	CLIP-seq
MIRT2450198	hsa-miR-1275	CLIP-seq
MIRT2450199	hsa-miR-1293	CLIP-seq
MIRT2450200	hsa-miR-3128	CLIP-seq
MIRT2450201	hsa-miR-3189-3p	CLIP-seq
MIRT2450202	hsa-miR-3198	CLIP-seq
MIRT2450203	hsa-miR-4259	CLIP-seq
MIRT2450204	hsa-miR-4309	CLIP-seq
MIRT2450205	hsa-miR-4483	CLIP-seq
MIRT2450206	hsa-miR-4653-3p	CLIP-seq
MIRT2450207	hsa-miR-4665-5p	CLIP-seq
MIRT2450208	hsa-miR-4715-5p	CLIP-seq
MIRT2450209	hsa-miR-4720-5p	CLIP-seq
MIRT2450210	hsa-miR-4731-5p	CLIP-seq
MIRT2450211	hsa-miR-4749-3p	CLIP-seq
MIRT2450212	hsa-miR-4799-3p	CLIP-seq
MIRT2450213	hsa-miR-578	CLIP-seq
MIRT2538396	hsa-miR-1184	CLIP-seq
MIRT2538397	hsa-miR-1205	CLIP-seq
MIRT2538398	hsa-miR-1324	CLIP-seq
MIRT2538399	hsa-miR-3158-5p	CLIP-seq
MIRT2538400	hsa-miR-3166	CLIP-seq
MIRT2538401	hsa-miR-4436b-3p	CLIP-seq
MIRT2538402	hsa-miR-4771	CLIP-seq
MIRT2538396	hsa-miR-1184	CLIP-seq
MIRT2538397	hsa-miR-1205	CLIP-seq
MIRT2538398	hsa-miR-1324	CLIP-seq
MIRT2538399	hsa-miR-3158-5p	CLIP-seq
MIRT2538400	hsa-miR-3166	CLIP-seq
MIRT2538401	hsa-miR-4436b-3p	CLIP-seq
MIRT2538402	hsa-miR-4771	CLIP-seq

Transcription factors

Show/Hide all(8)

Transcription factor	Regulation	Reference
EP300	Activation	20414733
NFIC	Unknown	19540848
NFKB1	Activation	16516312
NFKB1	Unknown	20471977
RELA	Activation	16516312
RELA	Unknown	20471977
STAT3	Activation	21833841
STAT3	Unknown	11740937

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	2740350
GO:0005515	Function	Protein binding	IPI	16189514, 17500595, 25416956, 25910212, 26871637, 29892012, 31515488, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IDA	12355421
GO:0005764	Component	Lysosome	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 25910212, 32296183
GO:0043254	Process	Regulation of protein-containing complex assembly	TAS	20176123
GO:0045109	Process	Intermediate filament organization	IDA	15732097
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:1904714	Process	Regulation of chaperone-mediated autophagy	ISS
GO:1904714	Process	Regulation of chaperone-mediated autophagy	TAS	20176123

MIM	HGNC	e!Ensembl
137780	4235	ENSG00000131095

Protein

UniProt ID

P14136

Protein name

Glial fibrillary acidic protein (GFAP)

Protein function

GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.

PDB

6A9P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04732	Filament_head	1 → 67	Intermediate filament head (DNA binding) region	Family
PF00038	Filament	68 → 376	Intermediate filament protein	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in cells lacking fibronectin. {ECO:0000269|PubMed:1847665}.

Sequence

MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM

Sequence length

432

Interactions

View interactions

	KEGG		Reactome
	JAK-STAT signaling pathway		Nuclear signaling by ERBB4

Show/Hide Causal Diseases (10)

Disease term	Disease name	dbSNP ID	References
Causal
Alexander disease	Alexander Disease, Alexander disease type II, Alexander disease type I	rs58064122, rs59565950, rs121909717, rs59285727, rs59793293, rs61622935, rs57120761, rs58732244, rs121909718, rs121909719, rs28932769, rs121909720, rs267607515, rs267607511, rs62636501 View all (24 more)	12581808, 16217707, 18584981, 18054694, 20849398, 15390001, 18217876, 17934883, 12447932, 23743246, 20359319, 11867077, 12638020, 24742911, 19412928 View all (80 more)
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis, Amyotrophic Lateral Sclerosis, Guam Form, Amyotrophic Lateral Sclerosis, Familial	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733 View all (171 more)	11723166, 11796754
Developmental regression	Developmental regression	rs1224421127
Epilepsy	Epilepsy, Epilepsy, Cryptogenic, Awakening Epilepsy	rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670 View all (165 more)	21177194
Hydrocephalus	Hydrocephalus	rs387907320, rs369384363, rs387907321, rs372127610, rs770273135, rs797045095, rs797045707, rs769795916, rs781251438, rs922703465, rs376078512, rs1567043467, rs1587149916, rs1586841546
Lateral sclerosis	AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic	rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048	11796754
Neuronal ceroid lipofuscinosis	Ceroid lipofuscinosis, neuronal 1, infantile	rs118203975, rs118203976, rs118203977, rs267607235, rs140948465, rs1740291234, rs386833969, rs104894385, rs104894386, rs121908292, rs267606738, rs1555274312, rs119455953, rs119455954, rs119455955 View all (397 more)	21224254
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	19276553
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	19405953, 15885920
Scoliosis	Scoliosis, unspecified	rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	11754076, 19000745, 25098258, 18585900	ClinVar
Alexander Disease	Alexander disease type II		GenCC

Show/Hide Text Mining Associations (209)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	37002988, 37268240, 39913635
Adenocarcinoma	Associate	35077636
Adenoma	Associate	33001343, 36307634
Adenoma Pleomorphic	Associate	17824792, 19668151
Adrenal Cortex Neoplasms	Associate	24755947
AIDS Associated Nephropathy	Inhibit	19886840
AIDS Associated Nephropathy	Associate	31805958
Airway Obstruction	Associate	39643430
Alexander Disease	Associate	11567214, 16168593, 17038307, 17043438, 18388212, 18402384, 18653683, 18685083, 20110364, 20964669, 21572052, 21756903, 21917775, 21987397, 22488673 View all (28 more)
Alzheimer Disease	Associate	19072283, 19686046, 19888461, 22832605, 23602650, 24269023, 2529544, 30040709, 30578620, 31454549, 32711556, 33049317, 33749648, 33905124, 34966527 View all (16 more)
Alzheimer Disease	Stimulate	34828359, 36776057, 38178159, 39940998
Amyotrophic Lateral Sclerosis	Associate	23341441, 24312501, 30572951, 33167591, 36525477
Amyotrophic Lateral Sclerosis	Stimulate	24312501
Anorexia	Associate	22198646
Aphasia Primary Progressive	Associate	35046935
Aphasia Primary Progressive	Stimulate	36707904
Arterio Arterial Fistula	Associate	33648532
Arthritis Rheumatoid	Associate	23418544
Astrocytoma	Associate	18691268, 19170683, 21075782, 23634874, 25973108, 26990854, 30520434, 33642282, 36350974, 8378327
Ataxia	Associate	23743246
Atrophy	Associate	22198646, 31937580, 36192766
Atrophy	Stimulate	26218733
Autism Spectrum Disorder	Stimulate	36769380
Autism Spectrum Disorder	Associate	37652704
Autistic Disorder	Associate	21901840
Bipolar Disorder	Associate	19488045
Brain Concussion	Associate	38643415
Brain Diseases	Associate	36811765, 37002988, 37924152
Brain Edema	Associate	24164438
Brain Injuries	Associate	30797587, 39290417, 39314520
Brain Injuries Traumatic	Associate	29969943, 30423808, 31417126
Brain Neoplasms	Inhibit	16457706
Brain Neoplasms	Associate	20235875, 33208163
Breast Neoplasms	Associate	37834358
Calcinosis	Associate	20964669
Carcinoma	Associate	13679444
Carcinoma Hepatocellular	Associate	22272636, 23601182
Central Nervous System Infections	Associate	29226988
Cerebral Cortical Thinning	Associate	37002988
Cerebral Infarction	Stimulate	24578611, 33734490, 39290417
Chemical and Drug Induced Liver Injury	Associate	18508359
Chondrosarcoma	Associate	19668151
Chondrosarcoma Extraskeletal Myxoid	Associate	22569967
Choroid Plexus Neoplasms	Associate	2438940
Cognition Disorders	Associate	32066474, 37500404
Cognition Disorders	Stimulate	36601110
Cognitive Dysfunction	Associate	19886840, 37537264
Cognitive Dysfunction	Stimulate	32066474
Colitis Ulcerative	Stimulate	21235736
Communicable Diseases	Stimulate	21235736
COVID 19	Associate	35063743, 36056566, 37834358
Creutzfeldt Jakob Disease Sporadic	Associate	23780662
Creutzfeldt Jakob Syndrome	Stimulate	30009661
Creutzfeldt Jakob Syndrome	Associate	30009661
Crohn Disease	Inhibit	21235736
Cytomegalovirus Infections	Inhibit	20071566
Death	Associate	31682229
Delirium	Associate	39210294
Dementia	Associate	37002988, 37834358, 37951931, 39643430
Demyelinating Autoimmune Diseases CNS	Associate	17043438
Demyelinating Diseases	Associate	24907905, 30388417
Dental Caries	Associate	20802180
Dentin dysplasia sclerotic bones	Associate	17515952
Depressive Disorder Major	Associate	33479350
Developmental Disabilities	Associate	30388417
Diabetes Mellitus	Associate	18709137
Diabetes Mellitus	Stimulate	23335850
Diabetic Retinopathy	Associate	35262732
Diabetic Retinopathy	Stimulate	36430950
Diffuse Cerebral Sclerosis of Schilder	Associate	37259148
Diffuse Intrinsic Pontine Glioma	Associate	24076776
Diffuse Neurofibrillary Tangles with Calcification	Associate	35164877
DiGeorge Syndrome	Associate	27801899
Down Syndrome	Associate	2529544, 29509279, 32819430, 37002988
Drug Related Side Effects and Adverse Reactions	Associate	31484723
Drug Resistant Epilepsy	Associate	21315622
Dystonic Disorders	Associate	37697307
Endometrial Stromal Tumors	Associate	30340515
Ependymoma	Associate	6192722
Epilepsia Partialis Continua	Associate	26719496
Epilepsy	Associate	30681365, 37833937
Epilepsy Familial Mesial Temporal Lobe	Stimulate	25889039
Epilepsy Post Traumatic	Associate	29188495
Epilepsy Temporal Lobe	Associate	31321953, 36274170
Epiretinal Membrane	Associate	12928287, 15156160, 29738569
Epstein Barr Virus Infections	Associate	36482607
Fever	Associate	36482607
Fibrosis	Associate	18508359
Focal Cortical Dysplasia	Associate	37587190
Focal Nodular Hyperplasia	Associate	32058355
Fragile X Syndrome	Associate	33993189
Fragile X Tremor Ataxia Syndrome	Associate	38069470
Frailty	Stimulate	40399764
Frasier Syndrome	Associate	28660986
Frontotemporal Dementia	Associate	31937580, 34633446, 39934339, 39940998
Frontotemporal Dementia	Stimulate	39577322
Frontotemporal Lobar Degeneration	Associate	20886841, 36215050
Gaucher Disease	Associate	31669751
Geographic Atrophy	Stimulate	12928288
Giant Axonal Neuropathy	Associate	27798231
Glaucoma	Associate	25837926
Glaucoma Open Angle	Associate	19145252
Glioblastoma	Associate	12084347, 12946225, 17189382, 17465990, 19216795, 19288188, 20154711, 20235875, 20383808, 24075410, 28677106, 29364250, 29746255, 31311947, 31534165 View all (5 more)
Glioblastoma	Inhibit	16457706
Glioma	Associate	10896661, 10936178, 18398462, 19813143, 20221446, 21075782, 22492246, 23589055, 23839947, 23852377, 27179220, 2825464, 30285781, 30770778, 33583081 View all (5 more)
Gliosarcoma	Associate	35381788
Gliosis	Stimulate	16516312
Gliosis	Associate	18402384, 20578042, 22153404, 22797933, 24269023, 28841900, 28981455, 31321953, 31937580, 35563594, 35951535, 37002988, 37697307
Glomerulonephritis Membranous	Associate	26120272
Gray Platelet Syndrome	Associate	34109421
Hamartoma	Associate	3189513
Heat Exhaustion	Associate	33479350
Hepatitis C Chronic	Associate	18508359
Hepatolenticular Degeneration	Associate	33502774
HIV Infections	Stimulate	22875918
HIV Infections	Associate	3472222, 36601110
Huntington Disease	Stimulate	32070434
Huntington Disease	Associate	38569376
Hyperkinesis	Stimulate	36769380
Hypertension	Stimulate	33734490
Hypoxia	Stimulate	22073257
Hypoxia	Associate	35335325
Hypoxia Brain	Stimulate	16516312
Hypoxia Brain	Associate	39290417
Immunoglobulin G4 Related Disease	Stimulate	26279003
Infarction	Stimulate	24578611
Infections	Associate	26637429
Inflammation	Associate	21235736, 25329999, 28392295, 35204724
Intellectual Disability	Associate	37652704
Intestinal Pseudo Obstruction	Associate	31144425
Irritable Bowel Syndrome	Stimulate	33797165
Leber Congenital Amaurosis	Stimulate	16052170
Leukemia Myeloid Acute	Inhibit	27016413
Leukodystrophy Metachromatic	Associate	26719496
Leukoencephalopathies	Associate	24755947, 36971196
Liver Failure Acute	Inhibit	24164438
Lymphoma Non Hodgkin	Associate	30393962
Macular Degeneration	Associate	12928288
Macular Degeneration	Stimulate	38087190
Medulloblastoma	Associate	19358275
Melanoma	Stimulate	12642316
Memory Disorders	Associate	24755947
Meningioma	Associate	20235875, 26352988
Meningitis Bacterial	Associate	20386697
Meningitis Viral	Associate	20386697
Mental Disorders	Associate	23272063, 39643430
Mental Disorders	Inhibit	31321953
Microphthalmia Syndromic 10	Associate	37500404
Mitral Valve Insufficiency	Associate	18388212
Mouth Diseases	Stimulate	28707765
Mucopolysaccharidosis VII	Stimulate	30413728
Multiple Sclerosis	Stimulate	17360586
Multiple Sclerosis	Associate	24907905, 31050367, 35204724, 37848007
Multiple Sclerosis Relapsing Remitting	Associate	35204724
Muscular Atrophy Spinal	Associate	31123861, 35951535
Muscular dystrophy congenital with central nervous system involvement	Associate	33502774
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	40082225
Myoepithelioma	Associate	19668151
Neoplasm Metastasis	Associate	29746255
Neoplasms	Associate	10193326, 11760389, 12373609, 12580553, 12923349, 12946225, 15861411, 18587711, 18652591, 18691268, 19170683, 19291000, 19668151, 21412926, 21701112 View all (33 more)
Neoplasms	Inhibit	21075782, 23601182
Neoplasms Neuroepithelial	Associate	15677537
Neovascularization Pathologic	Associate	38087190
Neurilemmoma	Associate	16357842
Neurilemmoma	Stimulate	26121316
Neurodegenerative Diseases	Associate	30040709, 33027920, 39290417, 39824235
Neurodegenerative Diseases	Stimulate	37500404
Neuroectodermal Tumors Primitive	Associate	28296680
Neuroinflammatory Diseases	Associate	35204724, 37137722
Neurotoxicity Syndromes	Associate	20578042
Niemann Pick Disease Type C	Associate	28841900
Norrie disease	Stimulate	31892365
Oculocutaneous albinism type 2	Associate	25997626
Oligodendroglioma	Associate	19934553
Optic Nerve Glioma	Associate	25124617
Osteosarcoma	Associate	19668151
Pain	Stimulate	22875918
Parkinson Disease	Associate	31828965
Persistent Infection	Associate	35073955
Pituitary Diseases	Associate	33001343
Pituitary Neoplasms	Associate	28660986, 33001343
Plaque Amyloid	Associate	23715664, 24269023
Prostatic Neoplasms	Associate	34222466
Psychomotor Disorders	Associate	30388417
Retinal Diseases	Associate	26279003
Retinal Drusen	Stimulate	12928288
Retinal Neoplasms	Associate	25837926
Retinal Perforations	Associate	27736918
Retinitis	Associate	36430950
Retinoblastoma	Associate	27488116
Rett Syndrome	Associate	24419315
Rhabdoid Tumor Predisposition Syndrome 1	Associate	20925002
Schizophrenia	Associate	19405953
Schizophrenia	Stimulate	27801899
Seizures	Associate	30388417
Skin Manifestations	Stimulate	33502774
Sleep Wake Disorders	Stimulate	31139831
Spasm	Associate	37652704
Spasms Infantile	Associate	17043438
Spastic Paraplegia Hereditary	Associate	37482941
Stroke	Associate	39824235
Trauma Nervous System	Associate	22897631
Tuberous Sclerosis	Associate	37652704
Urinary Bladder Diseases	Associate	39643430
Vitreoretinopathy Proliferative	Associate	15156160, 15988409, 28777835
Vocal Cord Paralysis	Associate	40043923
Vomiting	Associate	22198646, 35831840
Weight Loss	Associate	35831840
Wounds and Injuries	Stimulate	31417126

GFAP (glial fibrillary acidic protein)