RGS17 (regulator of G protein signaling 17)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26575
Gene name Gene Name - the full gene name approved by the HGNC.
Regulator of G protein signaling 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RGS17
Synonyms (NCBI Gene) Gene synonyms aliases
RGS-17, RGSZ2, hRGS17
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(185)
miRTarBase ID miRNA Experiments Reference
MIRT024057 hsa-miR-1-3p Microarray 18668037
MIRT028374 hsa-miR-32-5p Sequencing 20371350
MIRT671793 hsa-miR-562 HITS-CLIP 23824327
MIRT671792 hsa-miR-6819-3p HITS-CLIP 23824327
MIRT671791 hsa-miR-6877-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0001975 Process Response to amphetamine IEA
GO:0003924 Function GTPase activity TAS
GO:0005096 Function GTPase activator activity IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607191 14088 ENSG00000091844
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9UGC6
Protein name Regulator of G-protein signaling 17 (RGS17)
Protein function Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, ther
PDB 1ZV4 , 6AM3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00615 RGS 84 → 199 Regulator of G protein signaling domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the cerebellum. Also expressed in the cortex and medulla. Weakly expressed in a number of peripheral tissues notably spleen, lung and leukocytes. {ECO:0000269|PubMed:15096504}.
Sequence 
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
Sequence length 210
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    G alpha (q) signalling events
G alpha (i) signalling events
G alpha (z) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Malignant neoplasm of prostate, Prostate carcinoma rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 23535732, 29892016
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (13)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 15326299
Carcinogenesis Associate 21680864
Carcinoma Hepatocellular Associate 26059414
Carcinoma Non Small Cell Lung Associate 35041543
Diabetes Mellitus Type 2 Associate 26606528, 33290408
Drug Related Side Effects and Adverse Reactions Associate 21044322
Lung Neoplasms Associate 20142248, 23228068, 31081094
Neoplasm Metastasis Associate 21680864
Neoplasms Associate 23734683, 26059414, 29351497, 31298318
Ovarian Neoplasms Associate 21044322, 23734683, 33845140