Gene Gene information from NCBI Gene database.
Entrez ID 26575
Gene name Regulator of G protein signaling 17
Gene symbol RGS17
Synonyms (NCBI Gene)
RGS-17RGSZ2hRGS17
Chromosome 6
Chromosome location 6q25.2
Summary This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to
miRNA miRNA information provided by mirtarbase database.
185
miRTarBase ID miRNA Experiments Reference
MIRT024057 hsa-miR-1-3p Microarray 18668037
MIRT028374 hsa-miR-32-5p Sequencing 20371350
MIRT671793 hsa-miR-562 HITS-CLIP 23824327
MIRT671792 hsa-miR-6819-3p HITS-CLIP 23824327
MIRT671791 hsa-miR-6877-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0001975 Process Response to amphetamine IEA
GO:0003924 Function GTPase activity IEA
GO:0003924 Function GTPase activity TAS
GO:0005096 Function GTPase activator activity IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607191 14088 ENSG00000091844
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UGC6
Protein name Regulator of G-protein signaling 17 (RGS17)
Protein function Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, ther
PDB 1ZV4 , 6AM3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00615 RGS 84 199 Regulator of G protein signaling domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the cerebellum. Also expressed in the cortex and medulla. Weakly expressed in a number of peripheral tissues notably spleen, lung and leukocytes. {ECO:0000269|PubMed:15096504}.
Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSF
VESTAGSSSES
Sequence length 210
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    G alpha (q) signalling events
G alpha (i) signalling events
G alpha (z) signalling events