Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2642
Gene name Gene Name - the full gene name approved by the HGNC.	Glucagon receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GCGR
Synonyms (NCBI Gene) Gene synonyms aliases	GGR, GL-R, MVAH
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MVAH
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a glucagon receptor that is important in controlling blood glucose levels. Defects in this gene are a cause of non-insulin-dependent diabetes mellitus (NIDDM).[provided by RefSeq, Jan 2010]

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1801483	G>A	Pathogenic, benign	Coding sequence variant, missense variant, 5 prime UTR variant

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments
MIRT1014614	hsa-miR-1268	CLIP-seq
MIRT1014615	hsa-miR-1268b	CLIP-seq
MIRT1014616	hsa-miR-145	CLIP-seq
MIRT1014617	hsa-miR-198	CLIP-seq
MIRT1014618	hsa-miR-323b-5p	CLIP-seq
MIRT1014619	hsa-miR-3940-5p	CLIP-seq
MIRT1014620	hsa-miR-4277	CLIP-seq
MIRT1014621	hsa-miR-4314	CLIP-seq
MIRT1014622	hsa-miR-4447	CLIP-seq
MIRT1014623	hsa-miR-4472	CLIP-seq
MIRT1014624	hsa-miR-4488	CLIP-seq
MIRT1014625	hsa-miR-4507	CLIP-seq
MIRT1014626	hsa-miR-4651	CLIP-seq
MIRT1014627	hsa-miR-4697-5p	CLIP-seq
MIRT1014628	hsa-miR-585	CLIP-seq
MIRT1014629	hsa-miR-608	CLIP-seq
MIRT2233942	hsa-miR-3943	CLIP-seq
MIRT2233943	hsa-miR-4286	CLIP-seq
MIRT2388396	hsa-miR-361-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ECD	Repression	22908259

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004967	Function	Glucagon receptor activity	IBA	21873635
GO:0004967	Function	Glucagon receptor activity	IDA	9287038, 28514451
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	9287038
GO:0005887	Component	Integral component of plasma membrane	IMP	28514451
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	7773293
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IMP	9287038
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	28514451
GO:0007584	Process	Response to nutrient	TAS	7773293
GO:0008217	Process	Regulation of blood pressure	TAS	8563746
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA	21873635
GO:0009267	Process	Cellular response to starvation	ISS
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0016021	Component	Integral component of membrane	TAS	8144028
GO:0017046	Function	Peptide hormone binding	IBA	21873635
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042594	Process	Response to starvation	ISS
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0070873	Process	Regulation of glycogen metabolic process	ISS
GO:0071377	Process	Cellular response to glucagon stimulus	IDA	9287038
GO:0071377	Process	Cellular response to glucagon stimulus	TAS

MIM	HGNC	e!Ensembl
138033	4192	ENSG00000215644

Protein

UniProt ID

P47871

Protein name

Glucagon receptor (GL-R)

Protein function

G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an

PDB

2A83 , 3CZF , 4ERS , 4L6R , 4LF3 , 5EE7 , 5XEZ , 6LMK , 6LML , 6WHC , 6WPW , 7V35 , 8FU6 , 8JIQ , 8JIT , 8JIU , 8JRU , 8JRV , 8WG8 , 8YW5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	55 → 124	Hormone receptor domain	Family
PF00002	7tm_2	138 → 396	7 transmembrane receptor (Secretin family)	Family

Sequence

MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNR
TFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQ
CQMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANL
FASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYC
WLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDN
MGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGV
HEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL
GKVLWEERNTSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPF

Sequence length

477

Interactions

View interactions

	KEGG
	Neuroactive ligand-receptor interaction Hormone signaling Glucagon signaling pathway

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID
Causal
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Hyperglucagonemia	GCGR-related hyperglucagonemia			ClinVar

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma Islet Cell	Associate	19657311
Anxiety	Associate	22908259
Carcinoma Pancreatic Ductal	Associate	19657311
Carcinoma Renal Cell	Associate	26831905
Diabetes Mellitus	Associate	35381520
Diabetes Mellitus Type 2	Associate	25521597, 33097629
Glucagonoma	Associate	19657311
Insulinoma	Associate	29851790
Neoplasms Adipose Tissue	Associate	11707539
Sarcoma Endometrial Stromal	Associate	23178314

GCGR (glucagon receptor)