GCG (glucagon)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2641
Gene name Gene Name - the full gene name approved by the HGNC.
Glucagon
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GCG
Synonyms (NCBI Gene) Gene synonyms aliases
GLP-1, GLP1, GLP2, GRPP
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluc
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(22)
miRTarBase ID miRNA Experiments Reference
MIRT444741 hsa-miR-4699-5p PAR-CLIP 22100165
MIRT444740 hsa-miR-3611 PAR-CLIP 22100165
MIRT444741 hsa-miR-4699-5p PAR-CLIP 22100165
MIRT444740 hsa-miR-3611 PAR-CLIP 22100165
MIRT444740 hsa-miR-3611 Western blotting, qRT-PCR 35071451
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
Transcription factor Regulation Reference
FOXA1 Unknown 15828872;21824252
FOXA2 Unknown 15828872
ISL1 Unknown 21824252
PAX4 Repression 17426099
PAX6 Unknown 21824252
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(31)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 9990065
GO:0005179 Function Hormone activity IBA 21873635
GO:0005515 Function Protein binding IPI 17051221, 17715056, 21314817
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
138030 4191 ENSG00000115263
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P01275
Protein name Pro-glucagon [Cleaved into: Glicentin; Glicentin-related polypeptide (GRPP); Oxyntomodulin (OXM) (OXY); Glucagon; Glucagon-like peptide 1 (GLP-1) (Incretin hormone); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));
Protein function [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-indu
PDB 1BH0 , 1D0R , 1NAU , 2G49 , 2L63 , 2L64 , 2M5P , 2M5Q , 3IOL , 4APD , 4ZGM , 5OTU , 5OTV , 5OTW , 5OTX , 5VAI , 5YQZ , 6EDS , 6LMK , 6LML , 6NZN , 6PHI , 6PHJ , 6PHK , 6PHL , 6PHO , 6PHP , 6VCB , 6X18 , 7D68 , 7DUQ , 7KI0 , 7KI1 , 7XM8 , 8ANJ , 8ANK , 8JRV , 9IVG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00123 Hormone_2 53 → 80 Peptide hormone Family
PF00123 Hormone_2 98 → 125 Peptide hormone Family
PF00123 Hormone_2 146 → 173 Peptide hormone Family
Tissue specificity TISSUE SPECIFICITY: [Glucagon]: Secreted in the A cells of the islets of Langerhans. {ECO:0000269|PubMed:22037645}.; TISSUE SPECIFICITY: [Glucagon-like peptide 1]: Secreted in the A cells of the islets of Langerhans (PubMed:22037645). Secreted from entero
Sequence 
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Sequence length 180
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Thermogenesis
Insulin secretion
Glucagon signaling pathway 		  Glucagon signaling in metabolic regulation
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
G alpha (q) signalling events
G alpha (s) signalling events
Glucagon-type ligand receptors
Synthesis, secretion, and deacylation of Ghrelin
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (6)
Causal
Disease term Disease name dbSNP ID References
Colonic neoplasms Malignant tumor of colon, Colonic Neoplasms rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 22323126
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 23466488
Hyperinsulinism Hyperinsulinism rs387906407, rs151344623, rs121913156, rs137853245, rs80356655, rs104894010, rs104894012, rs104894014, rs104894015, rs137852676, rs587783169, rs72559716, rs541269678, rs151344624, rs797045209
View all (23 more)		 3019152
Hyperlipidemia Hyperlipidemia rs118204057, rs118204060, rs118204062, rs1563569634, rs118204069, rs118204070, rs118204071, rs1566946168, rs1064797075 69995
Show/Hide Unknown Diseases (5)
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure 7608802 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 7608802 ClinVar
Myocardial infarction Myocardial Failure 7608802 ClinVar
Multiple Sclerosis Multiple Sclerosis GWAS
Show/Hide Text Mining Associations (98)
Associations from Text Mining
Disease Name Relationship Type References
3C syndrome Inhibit 40244011
Adenocarcinoma of Lung Associate 32384511
Adenoma Associate 20087348
Alzheimer Disease Inhibit 35654594
Amyotrophic Lateral Sclerosis Associate 26198021
Atherosclerosis Inhibit 27771154
Bone Diseases Associate 33852173
Carcinoma Pancreatic Ductal Associate 19571666, 31731384, 40244011
Cardiovascular Diseases Stimulate 20470376
Cardiovascular Diseases Inhibit 24835252