Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26298
Gene name Gene Name - the full gene name approved by the HGNC.
ETS homologous factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EHF
Synonyms (NCBI Gene) Gene synonyms aliases
ESE3, ESE3B, ESEJ
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be involved in epithelial differentiation and carcino
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017515 hsa-miR-335-5p Microarray 18185580
MIRT955545 hsa-miR-1279 CLIP-seq
MIRT955546 hsa-miR-224 CLIP-seq
MIRT955547 hsa-miR-27a CLIP-seq
MIRT955548 hsa-miR-27b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 17027647
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 10644770, 17027647
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605439 3246 ENSG00000135373
Protein
UniProt ID Q9NZC4
Protein name ETS homologous factor (hEHF) (ETS domain-containing transcription factor) (Epithelium-specific Ets transcription factor 3) (ESE-3)
Protein function Transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. May act as a repressor for a specific subset of ETS/AP-1-responsive genes and as a modulator of the nuclear response to mitogen-activ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02198 SAM_PNT 31 115 Sterile alpha motif (SAM)/Pointed domain Domain
PF00178 Ets 208 289 Ets-domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, prostate, and lung. Weakly expressed in kidney and colon. Not detected in heart, brain, placenta, liver, skele
Sequence
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQ
HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNG
QCSSD
LFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLP
VAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFL
KSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFG
KNARGWRENEN
Sequence length 300
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 25648666
Breast Neoplasms Associate 17172821
Carcinogenesis Associate 20479932, 25950810
Carcinoid Tumor Associate 28461336
Carcinoma Non Small Cell Lung Associate 24445599
Carcinoma Pancreatic Ductal Associate 38308339
COVID 19 Associate 35196333
Cystic Disease Of Lung Associate 28549169
Cystic Fibrosis Associate 24105369, 28461336, 31557407
Esophageal Squamous Cell Carcinoma Associate 25950810