Gene Gene information from NCBI Gene database.
Entrez ID 26292
Gene name MYC binding protein
Gene symbol MYCBP
Synonyms (NCBI Gene)
AMY-1
Chromosome 1
Chromosome location 1p34.3
Summary The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus d
miRNA miRNA information provided by mirtarbase database.
327
miRTarBase ID miRNA Experiments Reference
MIRT005505 hsa-miR-22-3p ImmunoblotLuciferase reporter assayqRT-PCR 20562918
MIRT005505 hsa-miR-22-3p ImmunoblotLuciferase reporter assayqRT-PCR 20562918
MIRT023295 hsa-miR-122-5p Microarray 17612493
MIRT028305 hsa-miR-32-5p Sequencing 20371350
MIRT032374 hsa-let-7b-5p Proteomics 18668040
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
LEF1 Activation 15979100
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IBA
GO:0003713 Function Transcription coactivator activity IDA 9797456
GO:0003713 Function Transcription coactivator activity IEA
GO:0005515 Function Protein binding IPI 12151104, 12223483, 12740381, 16866877, 33961781, 35271311
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606535 7554 ENSG00000214114
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99417
Protein name c-Myc-binding protein (Associate of Myc 1) (AMY-1)
Protein function May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
PDB 2YY0
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.
Sequence
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Sequence length 103
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Carcinogenesis Associate 36407085
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 31385398
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 31094023
★☆☆☆☆
Found in Text Mining only
COVID 19 Associate 35064006
★☆☆☆☆
Found in Text Mining only
Leukemia Associate 36581344
★☆☆☆☆
Found in Text Mining only
Lymphoma T Cell Cutaneous Associate 26244872
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Associate 25330074
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 20966545
★☆☆☆☆
Found in Text Mining only
Neoplasms Inhibit 25330074
★☆☆☆☆
Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 36581344
★☆☆☆☆
Found in Text Mining only