Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26292
Gene name Gene Name - the full gene name approved by the HGNC.
MYC binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYCBP
Synonyms (NCBI Gene) Gene synonyms aliases
AMY-1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus d
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005505 hsa-miR-22-3p Immunoblot, Luciferase reporter assay, qRT-PCR 20562918
MIRT005505 hsa-miR-22-3p Immunoblot, Luciferase reporter assay, qRT-PCR 20562918
MIRT023295 hsa-miR-122-5p Microarray 17612493
MIRT028305 hsa-miR-32-5p Sequencing 20371350
MIRT032374 hsa-let-7b-5p Proteomics 18668040
Transcription factors
Transcription factor Regulation Reference
LEF1 Activation 15979100
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IBA 21873635
GO:0003713 Function Transcription coactivator activity IDA 9797456
GO:0005515 Function Protein binding IPI 12151104, 12223483, 16866877
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 9797456
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606535 7554 ENSG00000214114
Protein
UniProt ID Q99417
Protein name c-Myc-binding protein (Associate of Myc 1) (AMY-1)
Protein function May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
PDB 2YY0
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.
Sequence
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Sequence length 103
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenoid Cystic Carcinoma rs121913530, rs886039394, rs121913474 23685749
Unknown
Disease term Disease name Evidence References Source
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinogenesis Associate 36407085
Carcinoma Hepatocellular Associate 31385398
Colorectal Neoplasms Associate 31094023
COVID 19 Associate 35064006
Leukemia Associate 36581344
Lymphoma T Cell Cutaneous Associate 26244872
Multiple Myeloma Associate 25330074
Neoplasms Associate 20966545
Neoplasms Inhibit 25330074
Precursor T Cell Lymphoblastic Leukemia Lymphoma Associate 36581344