Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	26281
Gene name Gene Name - the full gene name approved by the HGNC.	Fibroblast growth factor 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FGF20
Synonyms (NCBI Gene) Gene synonyms aliases	FGF-20, RHDA2
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p22
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the fibroblast growth factor family. The fibroblast growth factors possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development,

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777282	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1585100306	C>T	Likely-pathogenic	Splice acceptor variant

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001741	hsa-miR-433-3p	Luciferase reporter assay, Western blot	18252210
MIRT001741	hsa-miR-433-3p	Luciferase reporter assay	18252210
MIRT001741	hsa-miR-433-3p	Other	18252210
MIRT2229346	hsa-miR-1236	CLIP-seq
MIRT2229347	hsa-miR-587	CLIP-seq
MIRT2229348	hsa-miR-668	CLIP-seq

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	11306498
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	10913340
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0007165	Process	Signal transduction	TAS	10913340
GO:0007267	Process	Cell-cell signaling	TAS	10913340
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	11306498
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS	11306498, 16988046
GO:0014059	Process	Regulation of dopamine secretion	TAS	16988046
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0042491	Process	Inner ear auditory receptor cell differentiation	IEA
GO:0043395	Function	Heparan sulfate proteoglycan binding	TAS	11306498
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	16988046
GO:0045664	Process	Regulation of neuron differentiation	IEA
GO:0060043	Process	Regulation of cardiac muscle cell proliferation	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0090722	Function	Receptor-receptor interaction	IDA	24157794
GO:1904340	Process	Positive regulation of dopaminergic neuron differentiation	TAS	18982104

MIM	HGNC	e!Ensembl
605558	3677	ENSG00000078579

Protein

UniProt ID

Q9NP95

Protein name

Fibroblast growth factor 20 (FGF-20)

Protein function

Neurotrophic factor that regulates central nervous development and function.

PDB

3F1R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	65 → 191	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in the cerebellum. {ECO:0000269|PubMed:11306498}.

Sequence

MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Sequence length

211

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Regulation of actin cytoskeleton Pathways in cancer Chemical carcinogenesis - receptor activation Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling Signaling by activated point mutants of FGFR1 Signaling by activated point mutants of FGFR3 FGFR4 ligand binding and activation FGFR3b ligand binding and activation FGFR3c ligand binding and activation FGFR1c ligand binding and activation FGFR2c ligand binding and activation FGFR3 mutant receptor activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer Phospholipase C-mediated cascade: FGFR1 Phospholipase C-mediated cascade; FGFR2 Phospholipase C-mediated cascade; FGFR3 Phospholipase C-mediated cascade; FGFR4 Downstream signaling of activated FGFR1 SHC-mediated cascade:FGFR1 PI-3K cascade:FGFR1 FRS-mediated FGFR1 signaling PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling PI-3K cascade:FGFR3 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Signaling by FGFR2 in disease Signaling by FGFR1 in disease RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Signaling by FGFR3 point mutants in cancer

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
RENAL HYPODYSPLASIA/APLASIA	renal hypodysplasia/aplasia 2	rs587777282, rs1585100306	N/A

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Allergic rhinitis in asthma	N/A	N/A	GWAS
Parkinson disease	parkinson disease, late-onset	N/A	N/A	ClinVar
Renal Agenesis	bilateral renal agenesis	N/A	N/A	GenCC

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Asthma	Associate	36255742
Bovine Respiratory Disease Complex	Associate	18252210
Depressive Disorder	Associate	30241547
Disease Progression	Inhibit	34193611
Kidney Failure Chronic	Inhibit	34193611
Malocclusion Angle Class III	Associate	28640125
Neurodegenerative Diseases	Associate	27341347
Parkinson Disease	Associate	15122513, 18252210, 19133659, 23394771, 26535683, 33349842
Squamous Cell Carcinoma of Head and Neck	Associate	34051764

FGF20 (fibroblast growth factor 20)