Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26281
Gene name Gene Name - the full gene name approved by the HGNC.
Fibroblast growth factor 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FGF20
Synonyms (NCBI Gene) Gene synonyms aliases
FGF-20, RHDA2
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the fibroblast growth factor family. The fibroblast growth factors possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development,
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777282 C>- Pathogenic Frameshift variant, coding sequence variant
rs1585100306 C>T Likely-pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001741 hsa-miR-433-3p Luciferase reporter assay, Western blot 18252210
MIRT001741 hsa-miR-433-3p Luciferase reporter assay 18252210
MIRT001741 hsa-miR-433-3p Other 18252210
MIRT2229346 hsa-miR-1236 CLIP-seq
MIRT2229347 hsa-miR-587 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 11306498
GO:0005104 Function Fibroblast growth factor receptor binding IBA
GO:0005104 Function Fibroblast growth factor receptor binding IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS 10913340
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605558 3677 ENSG00000078579
Protein
UniProt ID Q9NP95
Protein name Fibroblast growth factor 20 (FGF-20)
Protein function Neurotrophic factor that regulates central nervous development and function.
PDB 3F1R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00167 FGF 65 191 Fibroblast growth factor Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the cerebellum. {ECO:0000269|PubMed:11306498}.
Sequence
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFL
PRPVDPERVPELYKDLLMYT
Sequence length 211
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Chemical carcinogenesis - receptor activation
Melanoma
Breast cancer
Gastric cancer
  PI3K Cascade
PIP3 activates AKT signaling
Signaling by activated point mutants of FGFR1
Signaling by activated point mutants of FGFR3
FGFR4 ligand binding and activation
FGFR3b ligand binding and activation
FGFR3c ligand binding and activation
FGFR1c ligand binding and activation
FGFR2c ligand binding and activation
FGFR3 mutant receptor activation
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
Phospholipase C-mediated cascade: FGFR1
Phospholipase C-mediated cascade; FGFR2
Phospholipase C-mediated cascade; FGFR3
Phospholipase C-mediated cascade; FGFR4
Downstream signaling of activated FGFR1
SHC-mediated cascade:FGFR1
PI-3K cascade:FGFR1
FRS-mediated FGFR1 signaling
PI-3K cascade:FGFR2
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
SHC-mediated cascade:FGFR3
FRS-mediated FGFR3 signaling
PI-3K cascade:FGFR3
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signaling by FGFR2 in disease
Signaling by FGFR1 in disease
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR3 point mutants in cancer
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
RENAL HYPODYSPLASIA/APLASIA renal hypodysplasia/aplasia 2 rs587777282, rs1585100306 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Allergic rhinitis in asthma N/A N/A GWAS
Parkinson disease parkinson disease, late-onset N/A N/A ClinVar
Renal Agenesis bilateral renal agenesis N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 36255742
Bovine Respiratory Disease Complex Associate 18252210
Depressive Disorder Associate 30241547
Disease Progression Inhibit 34193611
Kidney Failure Chronic Inhibit 34193611
Malocclusion Angle Class III Associate 28640125
Neurodegenerative Diseases Associate 27341347
Parkinson Disease Associate 15122513, 18252210, 19133659, 23394771, 26535683, 33349842
Squamous Cell Carcinoma of Head and Neck Associate 34051764