Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26277
Gene name Gene Name - the full gene name approved by the HGNC.
TERF1 interacting nuclear factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TINF2
Synonyms (NCBI Gene) Gene synonyms aliases
DKCA3, DKCA5, TIN2
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the proteins of the shelterin, or telosome, complex which protects telomeres by allowing the cell to distinguish between telomeres and regions of DNA damage. The protein encoded by this gene is a critical part of shelterin; it int
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121918543 T>A,C Pathogenic Stop gained, coding sequence variant, 3 prime UTR variant, missense variant
rs121918544 C>T Pathogenic Missense variant, coding sequence variant, 3 prime UTR variant
rs121918545 G>A,T Pathogenic Missense variant, coding sequence variant, 3 prime UTR variant
rs142777869 G>T Benign, pathogenic, likely-benign Missense variant, coding sequence variant, 3 prime UTR variant
rs199422311 G>A,C Pathogenic Coding sequence variant, 3 prime UTR variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030020 hsa-miR-26b-5p Microarray 19088304
MIRT1425492 hsa-miR-3159 CLIP-seq
MIRT1425493 hsa-miR-4274 CLIP-seq
MIRT1425494 hsa-miR-4280 CLIP-seq
MIRT1425495 hsa-miR-4423-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
SP1 Unknown 9399940
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000781 Component Chromosome, telomeric region IDA 10581025, 12768206, 15133513, 15380063, 23685356, 24270157
GO:0000781 Component Chromosome, telomeric region IEA
GO:0000783 Component Nuclear telomere cap complex IDA 16880378
GO:0003677 Function DNA binding IDA 10581025
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604319 11824 ENSG00000092330
Protein
UniProt ID Q9BSI4
Protein name TERF1-interacting nuclear factor 2 (TRF1-interacting nuclear protein 2)
Protein function Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its
PDB 3BQO , 3BU8 , 5XYF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14973 TINF2_N 20 169 TERF1-interacting nuclear factor 2 N-terminus Family
Tissue specificity TISSUE SPECIFICITY: Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Sequence
MATPLVAGPAALRFAAAASWQVVRGRCVEHFPRVLEFLRSLRAVAPGLVRYRHHERLCMG
LKAKVVVELILQGRPWAQVLKALNHHFPESGPIVRDPKATKQDLRKILEAQETFYQQVKQ
LSEAPVDLASKLQELEQEYGEPFLAAMEKLLFEYLCQLEKALPTPQAQQ
LQDVLSWMQPG
VSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRLALHNPLPKAKPGTHL
PQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVI
SKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDLPATEQKENCLDCY
MDPLRLSLLPPRARKPVCPPSLCSSVITIGDLVLDSDEEENGQGEGKESLENYQKTKFDT
LIPTLCEYLPPSGHGAIPVSSCDCRDSSRPL
Sequence length 451
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Packaging Of Telomere Ends
Telomere Extension By Telomerase
DNA Damage/Telomere Stress Induced Senescence
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Dyskeratosis Congenita dyskeratosis congenita, dyskeratosis congenita, autosomal dominant 1, Dyskeratosis congenita, autosomal dominant 3 rs199422314, rs121918545, rs199422316, rs387907153, rs387907154, rs121918543, rs863223324, rs199422311, rs121918544, rs199422315 N/A
Revesz Syndrome revesz syndrome rs1594551449, rs121918544 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Aplastic anemia aplastic anemia N/A N/A ClinVar
Breast Cancer Malignant tumor of breast N/A N/A ClinVar
Carcinoma thyroid gland papillary carcinoma N/A N/A GenCC
Hoyeraal-Hreidarsson Syndrome Hoyeraal-Hreidarsson syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alveolitis Extrinsic Allergic Associate 31268371
Anemia Aplastic Associate 18669893, 21931702
Bone Marrow Failure Disorders Associate 21865325, 21931702, 25067791, 29742735, 35590014
Breast Neoplasms Associate 23342266, 35590014
Chromosome Aberrations Associate 28404540
COVID 19 Associate 34826456
Dyskeratosis Congenita Associate 18252230, 18669893, 19036115, 21199492, 21477109, 21536674, 21865325, 21931702, 22157096, 25067791, 26230315, 26859482, 29055871, 29581185, 29742735
View all (6 more)
Fibrosis Associate 34826456
Hereditary Breast and Ovarian Cancer Syndrome Associate 35590014
Hoyeraal Hreidarsson syndrome Associate 26810774, 33734615