Gene Gene information from NCBI Gene database.
Entrez ID 26263
Gene name F-box protein 22
Gene symbol FBXO22
Synonyms (NCBI Gene)
FBX22FISTC1TYMAS
Chromosome 15
Chromosome location 15q24.2
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
miRNA miRNA information provided by mirtarbase database.
183
miRTarBase ID miRNA Experiments Reference
MIRT046543 hsa-miR-1-3p CLASH 23622248
MIRT044372 hsa-miR-106b-5p CLASH 23622248
MIRT537422 hsa-miR-5692b PAR-CLIP 22012620
MIRT537421 hsa-miR-5692c PAR-CLIP 22012620
MIRT537420 hsa-miR-95-5p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IBA
GO:0000209 Process Protein polyubiquitination IEA
GO:0004842 Function Ubiquitin-protein transferase activity TAS 10531037
GO:0005515 Function Protein binding IPI 21145461, 26496610, 27705803, 32296183, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609096 13593 ENSG00000167196
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NEZ5
Protein name F-box only protein 22 (F-box protein FBX22p44)
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex that is implicated in the control of various cellular processes such as cell cycle control, transcriptional regulation, DNA damage repair, and
PDB 8S7D , 8S7E , 8UA3 , 8UA6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 21 67 F-box domain Domain
PF10442 FIST_C 278 365 FIST C domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in liver, also enriched in cardiac muscle. {ECO:0000269|PubMed:22972877}.
Sequence
MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVL
RTHRSVT
WISAGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGH
KRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFP
QIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVV
STFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEK
TAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGN
GEIGC
DRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
Sequence length 403
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Salmonella infection   Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Neurodevelopmental disorder Pathogenic rs2141698833 RCV004798925
Tayoun-Maawali syndrome Pathogenic rs2141698833 RCV005401853
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 34215846
Carcinogenesis Inhibit 36112263
Carcinoma Non Small Cell Lung Associate 34795058, 38296976
Carcinoma Pancreatic Ductal Stimulate 35046938
Lung Neoplasms Associate 38296976
Neoplasm Metastasis Inhibit 36112263
Neoplasms Associate 28117675, 34215846, 34795058, 36068491
Triple Negative Breast Neoplasms Inhibit 36112263