Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26263
Gene name Gene Name - the full gene name approved by the HGNC.
F-box protein 22
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXO22
Synonyms (NCBI Gene) Gene synonyms aliases
FBX22, FISTC1, TYMAS
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT046543 hsa-miR-1-3p CLASH 23622248
MIRT044372 hsa-miR-106b-5p CLASH 23622248
MIRT537422 hsa-miR-5692b PAR-CLIP 22012620
MIRT537421 hsa-miR-5692c PAR-CLIP 22012620
MIRT537420 hsa-miR-95-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IBA
GO:0000209 Process Protein polyubiquitination IEA
GO:0004842 Function Ubiquitin-protein transferase activity TAS 10531037
GO:0005515 Function Protein binding IPI 21145461, 26496610, 27705803, 32296183, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609096 13593 ENSG00000167196
Protein
UniProt ID Q8NEZ5
Protein name F-box only protein 22 (F-box protein FBX22p44)
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex that is implicated in the control of various cellular processes such as cell cycle control, transcriptional regulation, DNA damage repair, and
PDB 8S7D , 8S7E , 8UA3 , 8UA6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 21 67 F-box domain Domain
PF10442 FIST_C 278 365 FIST C domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in liver, also enriched in cardiac muscle. {ECO:0000269|PubMed:22972877}.
Sequence
MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVL
RTHRSVT
WISAGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGH
KRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFP
QIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVV
STFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEK
TAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGN
GEIGC
DRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
Sequence length 403
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Salmonella infection   Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 34215846
Carcinogenesis Inhibit 36112263
Carcinoma Non Small Cell Lung Associate 34795058, 38296976
Carcinoma Pancreatic Ductal Stimulate 35046938
Lung Neoplasms Associate 38296976
Neoplasm Metastasis Inhibit 36112263
Neoplasms Associate 28117675, 34215846, 34795058, 36068491
Triple Negative Breast Neoplasms Inhibit 36112263