Gene Gene information from NCBI Gene database.
Entrez ID 26260
Gene name F-box protein 25
Gene symbol FBXO25
Synonyms (NCBI Gene)
FBX25
Chromosome 8
Chromosome location 8p23.3
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
miRNA miRNA information provided by mirtarbase database.
69
miRTarBase ID miRNA Experiments Reference
MIRT024524 hsa-miR-215-5p Microarray 19074876
MIRT026896 hsa-miR-192-5p Microarray 19074876
MIRT649089 hsa-miR-548c-3p HITS-CLIP 23313552
MIRT685428 hsa-miR-3675-3p HITS-CLIP 23313552
MIRT685427 hsa-miR-3613-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex NAS 10531035
GO:0003779 Function Actin binding IEA
GO:0004842 Function Ubiquitin-protein transferase activity NAS 10531035
GO:0005515 Function Protein binding IPI 20473970, 32296183, 32814053
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609098 13596 ENSG00000147364
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TCJ0
Protein name F-box only protein 25
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT) (By similarity).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in all brain tissue observed. {ECO:0000269|PubMed:16278047}.
Sequence
MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEH
EYASKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIR
RFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL
CILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNIL
YRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMY
FALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPDSCFTPVSPQH
FIDLFKF
Sequence length 367
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  FoxO signaling pathway  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Uncertain significance rs558624439 RCV005932640
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 27596142
Carcinoma Non Small Cell Lung Associate 27596142
Epilepsy Associate 33925474
Gastrointestinal Stromal Tumors Associate 25987131
Lung Neoplasms Associate 27596142
Lymphatic Metastasis Stimulate 27596142
Neoplasms Associate 27556634, 40117808
Ovarian Neoplasms Associate 40117808