Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26260
Gene name Gene Name - the full gene name approved by the HGNC.
F-box protein 25
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXO25
Synonyms (NCBI Gene) Gene synonyms aliases
FBX25
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024524 hsa-miR-215-5p Microarray 19074876
MIRT026896 hsa-miR-192-5p Microarray 19074876
MIRT649089 hsa-miR-548c-3p HITS-CLIP 23313552
MIRT685428 hsa-miR-3675-3p HITS-CLIP 23313552
MIRT685427 hsa-miR-3613-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex NAS 10531035
GO:0003779 Function Actin binding IEA
GO:0004842 Function Ubiquitin-protein transferase activity NAS 10531035
GO:0005634 Component Nucleus IDA 16278047
GO:0005634 Component Nucleus ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609098 13596 ENSG00000147364
Protein
UniProt ID Q8TCJ0
Protein name F-box only protein 25
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT) (By similarity).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in all brain tissue observed. {ECO:0000269|PubMed:16278047}.
Sequence
MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEH
EYASKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIR
RFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL
CILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNIL
YRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMY
FALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPDSCFTPVSPQH
FIDLFKF
Sequence length 367
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  FoxO signaling pathway  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Moyamoya disease Moyamoya Disease, Moyamoya disease 1 rs121434527, rs121434528, rs387906592, rs397514563, rs797045187, rs1555675538, rs1568149971, rs1599150380, rs2079443410 29273593
Unknown
Disease term Disease name Evidence References Source
Moyamoya Disease Moyamoya Disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinogenesis Associate 27596142
Carcinoma Non Small Cell Lung Associate 27596142
Epilepsy Associate 33925474
Gastrointestinal Stromal Tumors Associate 25987131
Lung Neoplasms Associate 27596142
Lymphatic Metastasis Stimulate 27596142
Neoplasms Associate 27556634, 40117808
Ovarian Neoplasms Associate 40117808