CABYR (calcium binding tyrosine phosphorylation regulated)

Gene

• Entrez ID: 26256
• Gene name: Calcium binding tyrosine phosphorylation regulated
• Gene symbol: CABYR
• Synonyms (NCBI Gene): CABYRa, CABYRc, CABYRc/d, CABYRe, CBP86, CT88, FSP-2, FSP2
• Chromosome: 18
• Chromosome location: 18q11.2
• Summary: To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene lo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT046975	hsa-miR-221-3p	CLASH	23622248
MIRT046835	hsa-miR-222-3p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003351	Process	Epithelial cilium movement involved in extracellular fluid movement	NAS	18421703
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	11820818
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	15752768
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11820818, 18421703
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0017124	Function	SH3 domain binding	NAS	11820818
GO:0019899	Function	Enzyme binding	IPI	21274509
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031514	Component	Motile cilium	IDA	18421703
GO:0031514	Component	Motile cilium	IEA
GO:0035686	Component	Sperm fibrous sheath	IBA
GO:0035686	Component	Sperm fibrous sheath	IDA	11820818
GO:0035686	Component	Sperm fibrous sheath	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048240	Process	Sperm capacitation	IEA
GO:0048240	Process	Sperm capacitation	NAS	11820818
GO:0097228	Component	Sperm principal piece	IEA
GO:0097228	Component	Sperm principal piece	ISS
GO:0097229	Component	Sperm end piece	IEA

Other IDs

• MIM: 612135
• HGNC: 15569
• e!Ensembl: ENSG00000154040

Protein

• UniProt ID: O75952
• Protein name: Calcium-binding tyrosine phosphorylation-regulated protein (Calcium-binding protein 86) (Cancer/testis antigen 88) (CT88) (Fibrousheathin II) (Fibrousheathin-2) (FSP-2) (Testis-specific calcium-binding protein CBP86)
• Protein function: May function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction. Isoform 1 binds calcium in vitro. Isoform 2 and isoform 6 probably bind calcium. Isoform 3 and isoform 5 do not bind calc
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02197	RIIa	12 → 49	Regulatory subunit of type II PKA R-subunit	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in elongating spermatids and spermatozoa (at protein level). Isoform 1 is expressed in testis. Isoform 3 and isoform 5 are also expressed in brain, pancreas and numerous brain tumors. {ECO:0000269|PubMed:11820818, ECO:0000269
• Sequence:

  MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVK
  QFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
  QFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQML
  GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTS
  VHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVTLQADIEVMSTVHISSVYNDV
  PVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSV
  ESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE
  VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLT
  APEIEPEGESTAE

• Sequence length: 493