Gene Gene information from NCBI Gene database.
Entrez ID 26253
Gene name C-type lectin domain family 4 member E
Gene symbol CLEC4E
Synonyms (NCBI Gene)
CLECSF9MINCLE
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
miRNA miRNA information provided by mirtarbase database.
201
miRTarBase ID miRNA Experiments Reference
MIRT518202 hsa-miR-5692a PAR-CLIP 23446348
MIRT518201 hsa-miR-3529-3p PAR-CLIP 23446348
MIRT518200 hsa-miR-619-3p PAR-CLIP 23446348
MIRT518199 hsa-miR-7851-3p PAR-CLIP 23446348
MIRT518198 hsa-miR-6742-3p PAR-CLIP 23446348
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0001819 Process Positive regulation of cytokine production IEA
GO:0001891 Component Phagocytic cup IEA
GO:0002221 Process Pattern recognition receptor signaling pathway IMP 24101491
GO:0002292 Process T cell differentiation involved in immune response IEA
GO:0002376 Process Immune system process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609962 14555 ENSG00000166523
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9ULY5
Protein name C-type lectin domain family 4 member E (C-type lectin superfamily member 9) (Macrophage-inducible C-type lectin) (MINCLE)
Protein function Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and f
PDB 3WH2 , 3WH3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 97 207 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in monocytes and macrophages. {ECO:0000269|PubMed:23602766}.
Sequence
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLP
ENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINS
QEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCA
TMRDSSNPRQNWNDVTCFLNYFRICEM
VGINPLNKGKSL
Sequence length 219
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  C-type lectin receptor signaling pathway
Tuberculosis
  Dectin-2 family
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BRAIN INJURIES CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LUNG DISEASES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Arthritis Rheumatoid Associate 17082220
★☆☆☆☆
Found in Text Mining only
Diabetic Nephropathies Associate 36329882
★☆☆☆☆
Found in Text Mining only
Myocardial Infarction Associate 31863085
★☆☆☆☆
Found in Text Mining only
ST Elevation Myocardial Infarction Associate 31863085
★☆☆☆☆
Found in Text Mining only
Tuberculosis Pulmonary Associate 32971250
★☆☆☆☆
Found in Text Mining only
Urinary Bladder Neoplasms Associate 36131933
★☆☆☆☆
Found in Text Mining only