Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26253
Gene name Gene Name - the full gene name approved by the HGNC.
C-type lectin domain family 4 member E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLEC4E
Synonyms (NCBI Gene) Gene synonyms aliases
CLECSF9, MINCLE
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT518202 hsa-miR-5692a PAR-CLIP 23446348
MIRT518201 hsa-miR-3529-3p PAR-CLIP 23446348
MIRT518200 hsa-miR-619-3p PAR-CLIP 23446348
MIRT518199 hsa-miR-7851-3p PAR-CLIP 23446348
MIRT518198 hsa-miR-6742-3p PAR-CLIP 23446348
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002221 Process Pattern recognition receptor signaling pathway IMP 24101491
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway TAS
GO:0005509 Function Calcium ion binding IDA 24101491
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609962 14555 ENSG00000166523
Protein
UniProt ID Q9ULY5
Protein name C-type lectin domain family 4 member E (C-type lectin superfamily member 9) (Macrophage-inducible C-type lectin) (MINCLE)
Protein function Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and f
PDB 3WH2 , 3WH3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 97 207 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in monocytes and macrophages. {ECO:0000269|PubMed:23602766}.
Sequence
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLP
ENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINS
QEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCA
TMRDSSNPRQNWNDVTCFLNYFRICEM
VGINPLNKGKSL
Sequence length 219
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  C-type lectin receptor signaling pathway
Tuberculosis
  Dectin-2 family
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Takayasu Arteritis Takayasu Arteritis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 17082220
Diabetic Nephropathies Associate 36329882
Myocardial Infarction Associate 31863085
ST Elevation Myocardial Infarction Associate 31863085
Tuberculosis Pulmonary Associate 32971250
Urinary Bladder Neoplasms Associate 36131933