FBXL6 (F-box and leucine rich repeat protein 6)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26233
Gene name Gene Name - the full gene name approved by the HGNC.
F-box and leucine rich repeat protein 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXL6
Synonyms (NCBI Gene) Gene synonyms aliases
FBL6, FBL6A, PP14630
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of proteins that are characterized by an F-box motif. The encoded protein also contains leucine-rich repeats. F-box-containing proteins comprise one of the subunits of the SCF (SKP1-cullin-F-box) complex, which funct
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT029613 hsa-miR-26b-5p Microarray 19088304
MIRT991164 hsa-miR-3671 CLIP-seq
MIRT991165 hsa-miR-4698 CLIP-seq
MIRT991166 hsa-miR-495 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle IBA 21873635
GO:0004842 Function Ubiquitin-protein transferase activity TAS 10531035
GO:0005634 Component Nucleus IBA 21873635
GO:0005829 Component Cytosol IBA 21873635
GO:0006508 Process Proteolysis TAS 10531035
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609076 13603 ENSG00000182325
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8N531
Protein name F-box/LRR-repeat protein 6 (F-box and leucine-rich repeat protein 6) (F-box protein FBL6) (FBL6A)
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12937 F-box-like 113 → 163 F-box-like Domain
PF13516 LRR_6 382 → 405 Leucine Rich repeat Repeat
Sequence 
MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQ
RRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEIL
VQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKK
LLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADALVM
LAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSCCPQL
QVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEE
LCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGT
SDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNL
RGTRVTPSTVSSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS
Sequence length 539
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Brown-vialetto-van laere syndrome BROWN-VIALETTO-VAN LAERE SYNDROME 2 rs794728004, rs267606683, rs267606685, rs267606688, rs398124641, rs397514538, rs148234606, rs397514657, rs398123067, rs398123068, rs375088539, rs374071862, rs754320812, rs368924997, rs754753126
View all (12 more)
Show/Hide Text Mining Associations (5)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 39368786
Colorectal Neoplasms Associate 33568778, 39368786
Neoplasms Associate 33568778, 39368786
Ovarian Neoplasms Associate 39368786
Stomach Neoplasms Associate 39368786