FBXL6 (F-box and leucine rich repeat protein 6)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 26233
Gene name F-box and leucine rich repeat protein 6
Gene symbol FBXL6
Synonyms (NCBI Gene)
FBL6FBL6APP14630
Chromosome 8
Chromosome location 8q24.3
Summary This gene encodes a member of a family of proteins that are characterized by an F-box motif. The encoded protein also contains leucine-rich repeats. F-box-containing proteins comprise one of the subunits of the SCF (SKP1-cullin-F-box) complex, which funct
miRNA miRNA information provided by mirtarbase database.
4
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (4)
miRTarBase ID miRNA Experiments Reference
MIRT029613 hsa-miR-26b-5p Microarray 19088304
MIRT991164 hsa-miR-3671 CLIP-seq
MIRT991165 hsa-miR-4698 CLIP-seq
MIRT991166 hsa-miR-495 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity TAS 10531035
GO:0005515 Function Protein binding IPI 19159283, 27705803, 33961781
GO:0006508 Process Proteolysis TAS 10531035
GO:0019005 Component SCF ubiquitin ligase complex IBA
GO:0019005 Component SCF ubiquitin ligase complex IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
609076 13603 ENSG00000182325
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N531
Protein name F-box/LRR-repeat protein 6 (F-box and leucine-rich repeat protein 6) (F-box protein FBL6) (FBL6A)
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12937 F-box-like 113 → 163 F-box-like Domain
PF13516 LRR_6 382 → 405 Leucine Rich repeat Repeat
Sequence 
MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQ
RRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEIL
VQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKK
LLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADALVM
LAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSCCPQL
QVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEE
LCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGT
SDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNL
RGTRVTPSTVSSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS
Sequence length 539
Interactions View interactions