Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26228
Gene name Gene Name - the full gene name approved by the HGNC.
Signal transducing adaptor family member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STAP1
Synonyms (NCBI Gene) Gene synonyms aliases
BRDG1, STAP-1
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a proline-rich region, a pleckstrin homology (PH) domain, and a region in the carboxy terminal half with similarity to the Src Homology 2 (SH2) domain. This protein is a substrate of tyrosine-protein kinase Tec, a
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs793888522 A>G Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT735399 hsa-miR-587 Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, In situ hybridization, Flow cytometry, Immunocytochemistry (ICC) 33159017
MIRT1395020 hsa-miR-1298 CLIP-seq
MIRT1395021 hsa-miR-3161 CLIP-seq
MIRT1395022 hsa-miR-4511 CLIP-seq
MIRT1395023 hsa-miR-4662a-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001784 Function Phosphotyrosine residue binding IPI 20442417
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity IEA
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity ISS
GO:0005157 Function Macrophage colony-stimulating factor receptor binding IEA
GO:0005515 Function Protein binding IPI 15090612, 17936702, 21516116, 24728074, 25416956, 28514442, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604298 24133 ENSG00000035720
Protein
UniProt ID Q9ULZ2
Protein name Signal-transducing adaptor protein 1 (STAP-1) (BCR downstream-signaling protein 1) (Docking protein BRDG1) (Stem cell adaptor protein 1)
Protein function In BCR signaling, appears to function as a docking protein acting downstream of TEC and participates in a positive feedback loop by increasing the activity of TEC.
PDB 1X1F , 3MAZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 26 121 PH domain Domain
PF00017 SH2 179 256 SH2 domain Domain
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDK
KSIIYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
E
LSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYF
VKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPHIA
Sequence length 295
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hypercholesterolemia Hypercholesterolemia, familial, 1 rs793888522 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 33280515
Carcinoma Hepatocellular Inhibit 36713363
Coronary Artery Disease Associate 26036859
Hypercholesterolemia Autosomal Recessive Associate 25035151
Hyperlipoproteinemia Type II Associate 25035151, 26036859, 28958330, 30269829, 31427613, 35052492, 36648309
Hyperlipoproteinemia Type II Stimulate 26036859
Leukemia Myelogenous Chronic BCR ABL Positive Associate 33845308
Precursor B Cell Lymphoblastic Leukemia Lymphoma Associate 29330417
Spinocerebellar Ataxias Associate 36713363