Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26050
Gene name	SLIT and NTRK like family member 5
Gene symbol	SLITRK5
Synonyms (NCBI Gene)	LRRC11bA364G4.2
Chromosome	13
Chromosome location	13q31.2
Summary	Members of the SLITRK family, such as SLITRK5, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins (see SLIT1; MIM 603742). Most SLITRKs, including SLITRK5, also have C-terminal regions that

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1060499750	G>C	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT489485	hsa-miR-4428	PAR-CLIP	23592263
MIRT489484	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT489483	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT489482	hsa-miR-4784	PAR-CLIP	23592263
MIRT489481	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT489480	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT489479	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT489478	hsa-miR-4306	PAR-CLIP	23592263
MIRT489477	hsa-miR-4644	PAR-CLIP	23592263
MIRT489476	hsa-miR-765	PAR-CLIP	23592263
MIRT489475	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT489473	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT489474	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT489472	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT489471	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT489470	hsa-miR-3180	PAR-CLIP	23592263
MIRT489469	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT489468	hsa-miR-3196	PAR-CLIP	23592263
MIRT489467	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT489485	hsa-miR-4428	PAR-CLIP	23592263
MIRT489484	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT489483	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT489482	hsa-miR-4784	PAR-CLIP	23592263
MIRT489481	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT489480	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT489479	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT489478	hsa-miR-4306	PAR-CLIP	23592263
MIRT489477	hsa-miR-4644	PAR-CLIP	23592263
MIRT489476	hsa-miR-765	PAR-CLIP	23592263
MIRT489475	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT489473	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT489474	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT489472	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT489471	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT489470	hsa-miR-3180	PAR-CLIP	23592263
MIRT489469	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT489468	hsa-miR-3196	PAR-CLIP	23592263
MIRT489467	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT1369821	hsa-miR-3976	CLIP-seq
MIRT1369822	hsa-miR-455-3p	CLIP-seq
MIRT1369823	hsa-miR-568	CLIP-seq
MIRT2109774	hsa-miR-1228	CLIP-seq
MIRT2109775	hsa-miR-129-3p	CLIP-seq
MIRT2109776	hsa-miR-515-5p	CLIP-seq
MIRT2333128	hsa-miR-3647-3p	CLIP-seq
MIRT2109774	hsa-miR-1228	CLIP-seq
MIRT2394842	hsa-miR-1913	CLIP-seq
MIRT2394843	hsa-miR-3189-5p	CLIP-seq
MIRT2394844	hsa-miR-324-3p	CLIP-seq
MIRT2394845	hsa-miR-4758-3p	CLIP-seq
MIRT2109774	hsa-miR-1228	CLIP-seq
MIRT2109775	hsa-miR-129-3p	CLIP-seq
MIRT2394842	hsa-miR-1913	CLIP-seq
MIRT2459972	hsa-miR-194	CLIP-seq
MIRT2394843	hsa-miR-3189-5p	CLIP-seq
MIRT2394844	hsa-miR-324-3p	CLIP-seq
MIRT2459973	hsa-miR-3943	CLIP-seq
MIRT2459974	hsa-miR-4323	CLIP-seq
MIRT2459975	hsa-miR-4709-5p	CLIP-seq
MIRT2394845	hsa-miR-4758-3p	CLIP-seq
MIRT2109776	hsa-miR-515-5p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007409	Process	Axonogenesis	IBA
GO:0007409	Process	Axonogenesis	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016020	Component	Membrane	IEA
GO:0021756	Process	Striatum development	IEA
GO:0030534	Process	Adult behavior	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043588	Process	Skin development	IEA
GO:0045202	Component	Synapse	IEA
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0072359	Process	Circulatory system development	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099560	Process	Synaptic membrane adhesion	IDA	23345436
GO:0099560	Process	Synaptic membrane adhesion	IMP	23345436
GO:0150035	Process	Regulation of trans-synaptic signaling by BDNF, modulating synaptic transmission	IEA

MIM	HGNC	e!Ensembl
609680	20295	ENSG00000165300

O94991

Protein name

SLIT and NTRK-like protein 5 (Leucine-rich repeat-containing protein 11)

Protein function

Suppresses neurite outgrowth.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	105 → 165	Leucine rich repeat	Repeat
PF13855	LRR_8	129 → 189	Leucine rich repeat	Repeat
PF13855	LRR_8	154 → 212	Leucine rich repeat	Repeat
PF13855	LRR_8	412 → 469	Leucine rich repeat	Repeat
PF13855	LRR_8	457 → 517	Leucine rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in the cerebral cortex of the brain but also at low levels in the spinal cord and medulla. {ECO:0000269|PubMed:14557068}.

Sequence

MHTCCPPVTLEQDLHRKMHSWMLQTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGI
LTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDI
ETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLENLEYLQVDYNYISVIEPNAFGKLHLLQ
VLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGLLQHMDKVVELQLEENPWNCS
CELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRRLISDYEMRPQTPL
STTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPSKDLGYSNYGP
SIAYQTKSPVPLECPTACSCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENY
IAVVRRTDFLEATGLDLLHLGNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGL
QSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNLLQAMPSGVFSGLTLLRLNLRSNHF
TSLPVSGVLDQLKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAE
TDMRSIKSELLCPDYSDVVVSTPTPSSIQVPARTSAVTPAVRLNSTGAPASLGAGGGASS
VPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGGG
GGTGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREGNSVEDYKDLH
ELKVTYSSNHHLQQQQQPPPPPQQPQQQPPPQLQLQPGEEERRESHHLRSPAYSVSTIEP
REDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQ
YLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF

Sequence length

958

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules		Receptor-type tyrosine-protein phosphatases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal brain morphology	Likely pathogenic	rs1060499750	RCV000454171	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Autism spectrum disorder	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLITRK5-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Stimulate	40033250	★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Associate	39519164	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Primary	Associate	36102151	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	27599611	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive Compulsive Disorder	Associate	23154099	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	27708434	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLITRK5 (SLIT and NTRK like family member 5)