Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25942
Gene name	SIN3 transcription regulator family member A
Gene symbol	SIN3A
Synonyms (NCBI Gene)	CHR15DELq24DEL15Q24WITKOS
Chromosome	15
Chromosome location	15q24.2
Summary	The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex. [provided by RefSeq, Jul

Show/Hide all (22)

SNP ID	Visualize variation	Clinical significance	Consequence
rs879255618	->G	Pathogenic	Frameshift variant, coding sequence variant
rs879255619	TTCT>-	Pathogenic	Coding sequence variant, splice acceptor variant
rs879255620	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs879255621	G>A	Pathogenic	Coding sequence variant, stop gained
rs886037847	TC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064796919	G>A	Pathogenic	Stop gained, coding sequence variant
rs1135401768	GT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555441161	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555443581	CTTT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555443600	TT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555443627	C>T	Pathogenic	Stop gained, coding sequence variant
rs1555443682	GG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1555444022	T>C	Likely-pathogenic	Intron variant
rs1555444809	C>T	Likely-pathogenic	Splice acceptor variant
rs1555444879	G>A	Pathogenic	Stop gained, coding sequence variant
rs1555444885	G>A	Pathogenic	Stop gained, coding sequence variant
rs1567341422	T>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1567368243	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1595897112	A>C	Pathogenic	Coding sequence variant, stop gained
rs1595897117	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1595904430	->T	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1595907762	G>-	Pathogenic	Coding sequence variant, frameshift variant

401

Show/Hide all (401)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020539	hsa-miR-155-5p	Proteomics	18668040
MIRT023524	hsa-miR-1-3p	Proteomics	18668040
MIRT049314	hsa-miR-92a-3p	CLASH	23622248
MIRT040584	hsa-miR-92b-3p	CLASH	23622248
MIRT038894	hsa-miR-93-3p	CLASH	23622248
MIRT037870	hsa-miR-455-3p	CLASH	23622248
MIRT653815	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT653814	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT653813	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT653812	hsa-miR-5586-5p	HITS-CLIP	23824327
MIRT653811	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT653810	hsa-miR-4267	HITS-CLIP	23824327
MIRT653809	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT653808	hsa-miR-4265	HITS-CLIP	23824327
MIRT653807	hsa-miR-4296	HITS-CLIP	23824327
MIRT653806	hsa-miR-4322	HITS-CLIP	23824327
MIRT653804	hsa-miR-6796-5p	HITS-CLIP	23824327
MIRT653805	hsa-miR-6759-5p	HITS-CLIP	23824327
MIRT653803	hsa-miR-2113	HITS-CLIP	23824327
MIRT653802	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT439632	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT439630	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439632	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT439630	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT653803	hsa-miR-2113	PAR-CLIP	26701625
MIRT653808	hsa-miR-4265	PAR-CLIP	26701625
MIRT653807	hsa-miR-4296	PAR-CLIP	26701625
MIRT653806	hsa-miR-4322	PAR-CLIP	26701625
MIRT653802	hsa-miR-5010-3p	PAR-CLIP	26701625
MIRT653805	hsa-miR-6759-5p	PAR-CLIP	26701625
MIRT653804	hsa-miR-6796-5p	PAR-CLIP	26701625
MIRT653815	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT653814	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT653813	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT653812	hsa-miR-5586-5p	HITS-CLIP	23824327
MIRT653811	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT653810	hsa-miR-4267	HITS-CLIP	23824327
MIRT653809	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT653808	hsa-miR-4265	HITS-CLIP	23824327
MIRT653807	hsa-miR-4296	HITS-CLIP	23824327
MIRT653806	hsa-miR-4322	HITS-CLIP	23824327
MIRT653804	hsa-miR-6796-5p	HITS-CLIP	23824327
MIRT653805	hsa-miR-6759-5p	HITS-CLIP	23824327
MIRT653803	hsa-miR-2113	HITS-CLIP	23824327
MIRT653802	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT755677	hsa-miR-183-5p	Luciferase reporter assayWestern blottingqRT-PCR	35247910
MIRT755710	hsa-miR-183-3p	Luciferase reporter assayWestern blottingqRT-PCR	35247910
MIRT1349450	hsa-miR-101	CLIP-seq
MIRT1349451	hsa-miR-1193	CLIP-seq
MIRT1349452	hsa-miR-1275	CLIP-seq
MIRT1349453	hsa-miR-138	CLIP-seq
MIRT1349454	hsa-miR-146a	CLIP-seq
MIRT1349455	hsa-miR-146b-5p	CLIP-seq
MIRT1349456	hsa-miR-183	CLIP-seq
MIRT1349457	hsa-miR-185	CLIP-seq
MIRT1349458	hsa-miR-214	CLIP-seq
MIRT1349459	hsa-miR-2278	CLIP-seq
MIRT1349460	hsa-miR-2682	CLIP-seq
MIRT1349461	hsa-miR-3146	CLIP-seq
MIRT1349462	hsa-miR-3150b-3p	CLIP-seq
MIRT1349463	hsa-miR-3163	CLIP-seq
MIRT1349464	hsa-miR-3165	CLIP-seq
MIRT1349465	hsa-miR-320a	CLIP-seq
MIRT1349466	hsa-miR-320b	CLIP-seq
MIRT1349467	hsa-miR-320c	CLIP-seq
MIRT1349468	hsa-miR-320d	CLIP-seq
MIRT1349469	hsa-miR-320e	CLIP-seq
MIRT1349470	hsa-miR-3529	CLIP-seq
MIRT1349471	hsa-miR-3611	CLIP-seq
MIRT1349472	hsa-miR-3619-5p	CLIP-seq
MIRT1349473	hsa-miR-3691-5p	CLIP-seq
MIRT1349474	hsa-miR-379	CLIP-seq
MIRT1349475	hsa-miR-3919	CLIP-seq
MIRT1349476	hsa-miR-3927	CLIP-seq
MIRT1349477	hsa-miR-3973	CLIP-seq
MIRT1349478	hsa-miR-4259	CLIP-seq
MIRT1349479	hsa-miR-4271	CLIP-seq
MIRT1349480	hsa-miR-4306	CLIP-seq
MIRT1349481	hsa-miR-4429	CLIP-seq
MIRT1349482	hsa-miR-4456	CLIP-seq
MIRT1349483	hsa-miR-4459	CLIP-seq
MIRT1349484	hsa-miR-4488	CLIP-seq
MIRT1349485	hsa-miR-449c	CLIP-seq
MIRT1349486	hsa-miR-4644	CLIP-seq
MIRT1349487	hsa-miR-4665-5p	CLIP-seq
MIRT1349488	hsa-miR-4668-3p	CLIP-seq
MIRT1349489	hsa-miR-4697-5p	CLIP-seq
MIRT1349490	hsa-miR-4722-5p	CLIP-seq
MIRT1349491	hsa-miR-4725-3p	CLIP-seq
MIRT1349492	hsa-miR-4731-3p	CLIP-seq
MIRT1349493	hsa-miR-4756-3p	CLIP-seq
MIRT1349494	hsa-miR-4784	CLIP-seq
MIRT1349495	hsa-miR-4786-3p	CLIP-seq
MIRT1349496	hsa-miR-4801	CLIP-seq
MIRT1349497	hsa-miR-495	CLIP-seq
MIRT1349498	hsa-miR-520g	CLIP-seq
MIRT1349499	hsa-miR-520h	CLIP-seq
MIRT1349500	hsa-miR-548a-3p	CLIP-seq
MIRT1349501	hsa-miR-548ag	CLIP-seq
MIRT1349502	hsa-miR-548ai	CLIP-seq
MIRT1349503	hsa-miR-548e	CLIP-seq
MIRT1349504	hsa-miR-548f	CLIP-seq
MIRT1349505	hsa-miR-570	CLIP-seq
MIRT1349506	hsa-miR-580	CLIP-seq
MIRT1349507	hsa-miR-589	CLIP-seq
MIRT1349508	hsa-miR-592	CLIP-seq
MIRT1349509	hsa-miR-595	CLIP-seq
MIRT1349510	hsa-miR-597	CLIP-seq
MIRT1349511	hsa-miR-671-3p	CLIP-seq
MIRT1349512	hsa-miR-761	CLIP-seq
MIRT1349513	hsa-miR-873	CLIP-seq
MIRT1349514	hsa-miR-940	CLIP-seq
MIRT1349515	hsa-miR-1224-5p	CLIP-seq
MIRT1349516	hsa-miR-1304	CLIP-seq
MIRT1349517	hsa-miR-1324	CLIP-seq
MIRT1349518	hsa-miR-153	CLIP-seq
MIRT1349519	hsa-miR-1913	CLIP-seq
MIRT1349520	hsa-miR-2467-5p	CLIP-seq
MIRT1349521	hsa-miR-3124-3p	CLIP-seq
MIRT1349522	hsa-miR-3156-5p	CLIP-seq
MIRT1349523	hsa-miR-3188	CLIP-seq
MIRT1349524	hsa-miR-3189-5p	CLIP-seq
MIRT1349525	hsa-miR-323-5p	CLIP-seq
MIRT1349526	hsa-miR-324-3p	CLIP-seq
MIRT1349527	hsa-miR-3679-3p	CLIP-seq
MIRT1349528	hsa-miR-3689a-3p	CLIP-seq
MIRT1349529	hsa-miR-3689c	CLIP-seq
MIRT1349530	hsa-miR-3691-3p	CLIP-seq
MIRT1349531	hsa-miR-3910	CLIP-seq
MIRT1349532	hsa-miR-3940-5p	CLIP-seq
MIRT1349533	hsa-miR-3975	CLIP-seq
MIRT1349534	hsa-miR-4276	CLIP-seq
MIRT1349535	hsa-miR-4299	CLIP-seq
MIRT1349536	hsa-miR-4302	CLIP-seq
MIRT1349537	hsa-miR-4316	CLIP-seq
MIRT1349482	hsa-miR-4456	CLIP-seq
MIRT1349538	hsa-miR-4475	CLIP-seq
MIRT1349539	hsa-miR-4480	CLIP-seq
MIRT1349540	hsa-miR-4507	CLIP-seq
MIRT1349541	hsa-miR-4511	CLIP-seq
MIRT1349542	hsa-miR-4643	CLIP-seq
MIRT1349543	hsa-miR-4659a-3p	CLIP-seq
MIRT1349544	hsa-miR-4659b-3p	CLIP-seq
MIRT1349545	hsa-miR-466	CLIP-seq
MIRT1349546	hsa-miR-4693-3p	CLIP-seq
MIRT1349547	hsa-miR-4710	CLIP-seq
MIRT1349548	hsa-miR-4747-3p	CLIP-seq
MIRT1349549	hsa-miR-4751	CLIP-seq
MIRT1349550	hsa-miR-4758-3p	CLIP-seq
MIRT1349551	hsa-miR-4789-3p	CLIP-seq
MIRT1349552	hsa-miR-4792	CLIP-seq
MIRT1349553	hsa-miR-485-5p	CLIP-seq
MIRT1349554	hsa-miR-488	CLIP-seq
MIRT1349555	hsa-miR-490-3p	CLIP-seq
MIRT1349556	hsa-miR-502-5p	CLIP-seq
MIRT1349557	hsa-miR-548an	CLIP-seq
MIRT1349558	hsa-miR-548b-3p	CLIP-seq
MIRT1349559	hsa-miR-548q	CLIP-seq
MIRT1349560	hsa-miR-649	CLIP-seq
MIRT1349561	hsa-miR-665	CLIP-seq
MIRT1349562	hsa-miR-876-3p	CLIP-seq
MIRT1557023	hsa-miR-10a	CLIP-seq
MIRT1557024	hsa-miR-10b	CLIP-seq
MIRT1557025	hsa-miR-1283	CLIP-seq
MIRT1557026	hsa-miR-339-5p	CLIP-seq
MIRT1557027	hsa-miR-3667-5p	CLIP-seq
MIRT1557028	hsa-miR-4421	CLIP-seq
MIRT1557029	hsa-miR-451b	CLIP-seq
MIRT1557030	hsa-miR-4684-5p	CLIP-seq
MIRT1557031	hsa-miR-4696	CLIP-seq
MIRT1557032	hsa-miR-4725-5p	CLIP-seq
MIRT1557033	hsa-miR-504	CLIP-seq
MIRT1557034	hsa-miR-593	CLIP-seq
MIRT2103555	hsa-miR-3194-3p	CLIP-seq
MIRT2103556	hsa-miR-1278	CLIP-seq
MIRT2103557	hsa-miR-4287	CLIP-seq
MIRT1349488	hsa-miR-4668-3p	CLIP-seq
MIRT2103558	hsa-miR-4685-3p	CLIP-seq
MIRT2103559	hsa-miR-4803	CLIP-seq
MIRT1349554	hsa-miR-488	CLIP-seq
MIRT2103560	hsa-miR-607	CLIP-seq
MIRT2103561	hsa-miR-610	CLIP-seq
MIRT1349450	hsa-miR-101	CLIP-seq
MIRT2327697	hsa-miR-105	CLIP-seq
MIRT2327698	hsa-miR-1178	CLIP-seq
MIRT2327699	hsa-miR-1237	CLIP-seq
MIRT2327700	hsa-miR-1248	CLIP-seq
MIRT2327701	hsa-miR-1273e	CLIP-seq
MIRT2327702	hsa-miR-1276	CLIP-seq
MIRT2327703	hsa-miR-128	CLIP-seq
MIRT2327704	hsa-miR-1305	CLIP-seq
MIRT2327705	hsa-miR-136	CLIP-seq
MIRT1349453	hsa-miR-138	CLIP-seq
MIRT2327706	hsa-miR-141	CLIP-seq
MIRT2327707	hsa-miR-144	CLIP-seq
MIRT2327708	hsa-miR-1827	CLIP-seq
MIRT1349456	hsa-miR-183	CLIP-seq
MIRT1349457	hsa-miR-185	CLIP-seq
MIRT2327709	hsa-miR-200a	CLIP-seq
MIRT2327710	hsa-miR-204	CLIP-seq
MIRT2327711	hsa-miR-2054	CLIP-seq
MIRT2327712	hsa-miR-211	CLIP-seq
MIRT2327713	hsa-miR-217	CLIP-seq
MIRT1349459	hsa-miR-2278	CLIP-seq
MIRT2327714	hsa-miR-24	CLIP-seq
MIRT1349460	hsa-miR-2682	CLIP-seq
MIRT2327715	hsa-miR-27a	CLIP-seq
MIRT2327716	hsa-miR-27b	CLIP-seq
MIRT1349461	hsa-miR-3146	CLIP-seq
MIRT1349462	hsa-miR-3150b-3p	CLIP-seq
MIRT2327717	hsa-miR-3151	CLIP-seq
MIRT1349463	hsa-miR-3163	CLIP-seq
MIRT2327718	hsa-miR-3192	CLIP-seq
MIRT2327719	hsa-miR-3200-5p	CLIP-seq
MIRT2327720	hsa-miR-330-3p	CLIP-seq
MIRT1349470	hsa-miR-3529	CLIP-seq
MIRT2327721	hsa-miR-3667-3p	CLIP-seq
MIRT2327722	hsa-miR-3671	CLIP-seq
MIRT1349528	hsa-miR-3689a-3p	CLIP-seq
MIRT1349529	hsa-miR-3689c	CLIP-seq
MIRT1349474	hsa-miR-379	CLIP-seq
MIRT2327723	hsa-miR-382	CLIP-seq
MIRT2327724	hsa-miR-3923	CLIP-seq
MIRT2327725	hsa-miR-3925-3p	CLIP-seq
MIRT1349476	hsa-miR-3927	CLIP-seq
MIRT1349477	hsa-miR-3973	CLIP-seq
MIRT2327726	hsa-miR-3977	CLIP-seq
MIRT2103557	hsa-miR-4287	CLIP-seq
MIRT1349535	hsa-miR-4299	CLIP-seq
MIRT2327727	hsa-miR-4300	CLIP-seq
MIRT1349480	hsa-miR-4306	CLIP-seq
MIRT2327728	hsa-miR-431	CLIP-seq
MIRT2327729	hsa-miR-4311	CLIP-seq
MIRT2327730	hsa-miR-4327	CLIP-seq
MIRT2327731	hsa-miR-4422	CLIP-seq
MIRT1349482	hsa-miR-4456	CLIP-seq
MIRT2327732	hsa-miR-4477a	CLIP-seq
MIRT1349485	hsa-miR-449c	CLIP-seq
MIRT2327733	hsa-miR-4633-3p	CLIP-seq
MIRT1349486	hsa-miR-4644	CLIP-seq
MIRT1349488	hsa-miR-4668-3p	CLIP-seq
MIRT2327734	hsa-miR-4682	CLIP-seq
MIRT2103558	hsa-miR-4685-3p	CLIP-seq
MIRT2327735	hsa-miR-4698	CLIP-seq
MIRT1349492	hsa-miR-4731-3p	CLIP-seq
MIRT2327736	hsa-miR-4764-3p	CLIP-seq
MIRT1349494	hsa-miR-4784	CLIP-seq
MIRT1349496	hsa-miR-4801	CLIP-seq
MIRT1349554	hsa-miR-488	CLIP-seq
MIRT2327737	hsa-miR-491-3p	CLIP-seq
MIRT1349497	hsa-miR-495	CLIP-seq
MIRT2327738	hsa-miR-496	CLIP-seq
MIRT2327739	hsa-miR-501-3p	CLIP-seq
MIRT2327740	hsa-miR-502-3p	CLIP-seq
MIRT2327741	hsa-miR-511	CLIP-seq
MIRT2327742	hsa-miR-513a-5p	CLIP-seq
MIRT2327743	hsa-miR-515-5p	CLIP-seq
MIRT1349498	hsa-miR-520g	CLIP-seq
MIRT1349499	hsa-miR-520h	CLIP-seq
MIRT1349501	hsa-miR-548ag	CLIP-seq
MIRT1349502	hsa-miR-548ai	CLIP-seq
MIRT1349559	hsa-miR-548q	CLIP-seq
MIRT2327744	hsa-miR-548t	CLIP-seq
MIRT2327745	hsa-miR-583	CLIP-seq
MIRT1349509	hsa-miR-595	CLIP-seq
MIRT2327746	hsa-miR-605	CLIP-seq
MIRT2103560	hsa-miR-607	CLIP-seq
MIRT2103561	hsa-miR-610	CLIP-seq
MIRT2327747	hsa-miR-617	CLIP-seq
MIRT2327748	hsa-miR-621	CLIP-seq
MIRT2327749	hsa-miR-622	CLIP-seq
MIRT2327750	hsa-miR-628-3p	CLIP-seq
MIRT2327751	hsa-miR-643	CLIP-seq
MIRT2327752	hsa-miR-766	CLIP-seq
MIRT1349513	hsa-miR-873	CLIP-seq
MIRT2327753	hsa-miR-9	CLIP-seq
MIRT2327754	hsa-miR-920	CLIP-seq
MIRT2327755	hsa-miR-939	CLIP-seq
MIRT1349514	hsa-miR-940	CLIP-seq
MIRT2327702	hsa-miR-1276	CLIP-seq
MIRT2327708	hsa-miR-1827	CLIP-seq
MIRT1349470	hsa-miR-3529	CLIP-seq
MIRT1349474	hsa-miR-379	CLIP-seq
MIRT1349531	hsa-miR-3910	CLIP-seq
MIRT2327724	hsa-miR-3923	CLIP-seq
MIRT1349476	hsa-miR-3927	CLIP-seq
MIRT1349534	hsa-miR-4276	CLIP-seq
MIRT2327727	hsa-miR-4300	CLIP-seq
MIRT1349536	hsa-miR-4302	CLIP-seq
MIRT2327729	hsa-miR-4311	CLIP-seq
MIRT2327733	hsa-miR-4633-3p	CLIP-seq
MIRT1349543	hsa-miR-4659a-3p	CLIP-seq
MIRT1349544	hsa-miR-4659b-3p	CLIP-seq
MIRT1349556	hsa-miR-502-5p	CLIP-seq
MIRT1349501	hsa-miR-548ag	CLIP-seq
MIRT1349502	hsa-miR-548ai	CLIP-seq
MIRT2327745	hsa-miR-583	CLIP-seq
MIRT2103561	hsa-miR-610	CLIP-seq
MIRT2327750	hsa-miR-628-3p	CLIP-seq
MIRT2327754	hsa-miR-920	CLIP-seq
MIRT2433204	hsa-miR-1205	CLIP-seq
MIRT2433205	hsa-miR-3665	CLIP-seq
MIRT2433206	hsa-miR-4418	CLIP-seq
MIRT2433207	hsa-miR-509-3-5p	CLIP-seq
MIRT2433208	hsa-miR-509-5p	CLIP-seq
MIRT2433209	hsa-miR-577	CLIP-seq
MIRT2433210	hsa-miR-657	CLIP-seq
MIRT1557023	hsa-miR-10a	CLIP-seq
MIRT1557024	hsa-miR-10b	CLIP-seq
MIRT1349452	hsa-miR-1275	CLIP-seq
MIRT1557025	hsa-miR-1283	CLIP-seq
MIRT1557026	hsa-miR-339-5p	CLIP-seq
MIRT2459387	hsa-miR-3613-3p	CLIP-seq
MIRT1557027	hsa-miR-3667-5p	CLIP-seq
MIRT1349478	hsa-miR-4259	CLIP-seq
MIRT1557028	hsa-miR-4421	CLIP-seq
MIRT1349484	hsa-miR-4488	CLIP-seq
MIRT1349487	hsa-miR-4665-5p	CLIP-seq
MIRT1557030	hsa-miR-4684-5p	CLIP-seq
MIRT1349489	hsa-miR-4697-5p	CLIP-seq
MIRT1557032	hsa-miR-4725-5p	CLIP-seq
MIRT1557033	hsa-miR-504	CLIP-seq
MIRT1557034	hsa-miR-593	CLIP-seq
MIRT2622803	hsa-miR-103a	CLIP-seq
MIRT2622804	hsa-miR-107	CLIP-seq
MIRT1557023	hsa-miR-10a	CLIP-seq
MIRT1557024	hsa-miR-10b	CLIP-seq
MIRT2622805	hsa-miR-1228	CLIP-seq
MIRT2622806	hsa-miR-1268	CLIP-seq
MIRT2622807	hsa-miR-1268b	CLIP-seq
MIRT2103556	hsa-miR-1278	CLIP-seq
MIRT1557025	hsa-miR-1283	CLIP-seq
MIRT2622808	hsa-miR-1285	CLIP-seq
MIRT1349516	hsa-miR-1304	CLIP-seq
MIRT2327707	hsa-miR-144	CLIP-seq
MIRT2622809	hsa-miR-1825	CLIP-seq
MIRT2622810	hsa-miR-199a-5p	CLIP-seq
MIRT2622811	hsa-miR-199b-5p	CLIP-seq
MIRT2622812	hsa-miR-216a	CLIP-seq
MIRT2622813	hsa-miR-216b	CLIP-seq
MIRT2327714	hsa-miR-24	CLIP-seq
MIRT2622814	hsa-miR-3065-3p	CLIP-seq
MIRT1349521	hsa-miR-3124-3p	CLIP-seq
MIRT2622815	hsa-miR-3126-5p	CLIP-seq
MIRT1349522	hsa-miR-3156-5p	CLIP-seq
MIRT2622816	hsa-miR-3184	CLIP-seq
MIRT2622817	hsa-miR-3185	CLIP-seq
MIRT2622818	hsa-miR-3187-5p	CLIP-seq
MIRT2327718	hsa-miR-3192	CLIP-seq
MIRT2622819	hsa-miR-323-3p	CLIP-seq
MIRT1557026	hsa-miR-339-5p	CLIP-seq
MIRT2459387	hsa-miR-3613-3p	CLIP-seq
MIRT2622820	hsa-miR-3622b-5p	CLIP-seq
MIRT1557027	hsa-miR-3667-5p	CLIP-seq
MIRT2622821	hsa-miR-3672	CLIP-seq
MIRT1349527	hsa-miR-3679-3p	CLIP-seq
MIRT1349528	hsa-miR-3689a-3p	CLIP-seq
MIRT1349529	hsa-miR-3689c	CLIP-seq
MIRT2622822	hsa-miR-375	CLIP-seq
MIRT2622823	hsa-miR-3924	CLIP-seq
MIRT2327725	hsa-miR-3925-3p	CLIP-seq
MIRT2622824	hsa-miR-423-5p	CLIP-seq
MIRT2622825	hsa-miR-4283	CLIP-seq
MIRT1349536	hsa-miR-4302	CLIP-seq
MIRT2622826	hsa-miR-4419a	CLIP-seq
MIRT1557028	hsa-miR-4421	CLIP-seq
MIRT2622827	hsa-miR-4432	CLIP-seq
MIRT2622828	hsa-miR-4433	CLIP-seq
MIRT2622829	hsa-miR-4437	CLIP-seq
MIRT2622830	hsa-miR-4486	CLIP-seq
MIRT2622831	hsa-miR-450a	CLIP-seq
MIRT2622832	hsa-miR-4510	CLIP-seq
MIRT1557029	hsa-miR-451b	CLIP-seq
MIRT2622833	hsa-miR-4645-3p	CLIP-seq
MIRT1349488	hsa-miR-4668-3p	CLIP-seq
MIRT1557030	hsa-miR-4684-5p	CLIP-seq
MIRT1557031	hsa-miR-4696	CLIP-seq
MIRT1557032	hsa-miR-4725-5p	CLIP-seq
MIRT2622834	hsa-miR-4737	CLIP-seq
MIRT2622835	hsa-miR-4786-5p	CLIP-seq
MIRT2622836	hsa-miR-4793-3p	CLIP-seq
MIRT1349555	hsa-miR-490-3p	CLIP-seq
MIRT2622837	hsa-miR-499-5p	CLIP-seq
MIRT1557033	hsa-miR-504	CLIP-seq
MIRT2622838	hsa-miR-505	CLIP-seq
MIRT2622839	hsa-miR-508-5p	CLIP-seq
MIRT2622840	hsa-miR-526b	CLIP-seq
MIRT2622841	hsa-miR-539	CLIP-seq
MIRT2622842	hsa-miR-542-5p	CLIP-seq
MIRT2622843	hsa-miR-578	CLIP-seq
MIRT1349506	hsa-miR-580	CLIP-seq
MIRT2622844	hsa-miR-584	CLIP-seq
MIRT2622845	hsa-miR-585	CLIP-seq
MIRT1557034	hsa-miR-593	CLIP-seq
MIRT2622846	hsa-miR-602	CLIP-seq
MIRT2622847	hsa-miR-612	CLIP-seq
MIRT2622848	hsa-miR-628-5p	CLIP-seq
MIRT1349561	hsa-miR-665	CLIP-seq
MIRT2622849	hsa-miR-769-5p	CLIP-seq
MIRT2622850	hsa-miR-944	CLIP-seq
MIRT1557027	hsa-miR-3667-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
FOXK2	Unknown	24748658

Show/Hide all (68)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	9651585
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	22783022
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	9651585, 22865885
GO:0000776	Component	Kinetochore	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0002218	Process	Activation of innate immune response	IMP	22783022
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	22783022
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	IMP	22783022
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9651585, 10049357, 10220385, 10823891, 11238380, 11259580, 11359905, 12150998, 12670868, 14525983, 16254079, 17803295, 17956988, 18451802, 19729656, 20676127, 21258344, 23752268, 23770565, 25314079, 26496610, 26949739, 28514442, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	22783022
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	NAS	28554894
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0010817	Process	Regulation of hormone levels	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IEA
GO:0017053	Component	Transcription repressor complex	IEA
GO:0021895	Process	Cerebral cortex neuron differentiation	IEA
GO:0021895	Process	Cerebral cortex neuron differentiation	ISS
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0030516	Process	Regulation of axon extension	IEA
GO:0030516	Process	Regulation of axon extension	ISS
GO:0031507	Process	Heterochromatin formation	IMP	22783022
GO:0032991	Component	Protein-containing complex	IEA
GO:0042754	Process	Negative regulation of circadian rhythm	IEA
GO:0042754	Process	Negative regulation of circadian rhythm	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051595	Process	Response to methylglyoxal	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	22783022
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	22783022
GO:0070822	Component	Sin3-type complex	IBA
GO:0070822	Component	Sin3-type complex	IDA	14966270, 17827154
GO:0070822	Component	Sin3-type complex	NAS	22783022, 28554894
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0072736	Process	Cellular response to tert-butyl hydroperoxide	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	22783022
GO:1900181	Process	Negative regulation of protein localization to nucleus	IMP	22783022
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894
GO:1903351	Process	Cellular response to dopamine	IEA

MIM	HGNC	e!Ensembl
607776	19353	ENSG00000169375

Q96ST3

Protein name

Paired amphipathic helix protein Sin3a (Histone deacetylase complex subunit Sin3a) (Transcriptional corepressor Sin3a)

Protein function

Acts as a transcriptional repressor. Corepressor for REST. Interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities. Also interacts with MXD1-MAX heterodimers to repress transcription by tethering SIN3A to DNA.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02671	PAH	142 → 186	Paired amphipathic helix repeat	Repeat
PF02671	PAH	323 → 380	Paired amphipathic helix repeat	Repeat
PF02671	PAH	478 → 522	Paired amphipathic helix repeat	Repeat
PF08295	Sin3_corepress	552 → 647	Sin3 family co-repressor	Domain
PF16879	Sin3a_C	886 → 1186	C-terminal domain of Sin3a protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the developing brain, with highest levels of expression detected in the ventricular zone of various cortical regions. {ECO:0000269|PubMed:27399968}.

Sequence

MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTP
SYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
LKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIM
GFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQ
PAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYA
QVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP
SQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAY
ENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATE
GIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSS
KKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGT
SEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQ
NEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLA
YEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEE
EMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQ
ILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYP
AFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQV
TDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIE
LLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGR
EQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHE
RVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSIN
KYRVKYGTVFKAP

Sequence length

1273

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway Thyroid hormone signaling pathway Huntington disease Epstein-Barr virus infection Transcriptional misregulation in cancer		SUMOylation of transcription cofactors Regulation of lipid metabolism by PPARalpha RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function Loss of MECP2 binding ability to 5mC-DNA Regulation of MECP2 expression and activity

125

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Gastric cancer	Likely pathogenic; Pathogenic	rs1444395453	RCV005922606
Intellectual disability	Likely pathogenic; Pathogenic	rs1444395453	RCV005626493
Neurodevelopmental disorder	Likely pathogenic	rs2141487276	RCV001780008
See cases	Pathogenic	rs2141425807	RCV001420253
SIN3A-related disorder	Likely pathogenic; Pathogenic	rs1444395453, rs2543061981	RCV004731182 RCV003983364
SIN3A-related intellectual disability syndrome	Pathogenic; Likely pathogenic	rs971198723, rs2543076887, rs1555444885	RCV002471962 RCV002472036 RCV003403431
SIN3A-related intellectual disability syndrome due to a point mutation	Pathogenic; Likely pathogenic	rs2073271481, rs2073302769, rs2073599549, rs2141487525, rs2141415824, rs2141424841, rs1444395453, rs2141396556, rs2141368718, rs2141486160, rs2141540759, rs2542981693, rs2542787952, rs2542751349, rs971198723 View all (22 more)	RCV001332923 RCV001332922 RCV001332921 RCV001375977 RCV001754567 RCV001783749 RCV003493875 RCV001807952 RCV001823324 RCV002244196 RCV002274471 RCV002287619 RCV002290095 RCV002466369 RCV004565611 RCV003147954 RCV003148384 RCV000239471 RCV000239513 RCV000239566 RCV000239460 RCV000239512 RCV003341552 RCV003232888 RCV005624221 RCV003314312 RCV003883310 RCV004545920 RCV004555325 RCV004595243 RCV004595244 RCV000496119 RCV003985794 RCV001764519 RCV000754491 RCV000989361 RCV001196526

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Benign	rs4886696, rs71401694	RCV005924793 RCV005923749
Hepatocellular carcinoma	Benign	rs4886696	RCV005924794
Malignant lymphoma, large B-cell, diffuse	Benign	rs71401694	RCV005923751
Melanoma	Uncertain significance	rs202118407	RCV005930566
Ovarian serous cystadenocarcinoma	Likely benign	rs535260527	RCV005924324
Rare genetic intellectual disability	Uncertain significance	rs2543074935	RCV001257031
Thymoma	Benign	rs71401694	RCV005923753
Uterine carcinosarcoma	Benign	rs71401694	RCV005923752
Uterine corpus endometrial carcinoma	Benign; Conflicting classifications of pathogenicity	rs71401694, rs759972441	RCV005923754 RCV005931686
Uveal melanoma	Benign	rs71401694	RCV005923750

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alcohol Related Disorders	Associate	33437032
Arthritis Rheumatoid	Associate	23456299
Breast Neoplasms	Associate	20920219, 21737614, 28805661, 30375428, 33962648, 35406744, 37459799
Breast Neoplasms	Inhibit	35247910
Burkitt Lymphoma	Associate	30617194
Calcinosis Cutis	Associate	31668133
Carcinoma Hepatocellular	Associate	29658607
Carcinoma Non Small Cell Lung	Associate	37291119
Carcinoma Renal Cell	Associate	33232269, 34586647, 36367018
Dermatitis Atopic	Associate	27498343
Diabetes Mellitus	Associate	36790478
Glioma	Associate	25481483
Hypoxia	Associate	11158315, 24278015
Intellectual Disability	Associate	33437032
Leukemia Myeloid	Associate	26671595
Leukemia Myeloid Acute	Associate	29764005
Lymphoma Large Cell Anaplastic	Associate	23633923
Lymphoma Non Hodgkin	Associate	37828118
Muscle Hypotonia	Associate	33437032
Muscular Atrophy Spinal	Associate	14749338
Neoplasm Metastasis	Associate	28805661, 35247910
Neoplasms	Associate	11784859, 19585508, 25073741, 30375428
Neural Tube Defects	Associate	26671595
Pancreatic Neoplasms	Associate	25611699
Pulmonary Fibrosis	Associate	32991815
Sarcoma Synovial	Associate	15467731

SIN3A (SIN3 transcription regulator family member A)