TAS2R43 (taste 2 receptor member 43)

Gene

• Entrez ID: 259289
• Gene name: Taste 2 receptor member 43
• Gene symbol: TAS2R43
• Synonyms (NCBI Gene): T2R43, T2R52
• Chromosome: 12
• Chromosome location: 12p13.2
• Summary: TAS2R43 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway (Conte et al., 2002 [PubMed 12584440]). For furth

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	16720576, 20022913
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IC	16720576
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008527	Function	Taste receptor activity	IDA	16720576
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IC	16720576, 20022913
GO:0016020	Component	Membrane	IEA
GO:0031514	Component	Motile cilium	IDA	19628819
GO:0033038	Function	Bitter taste receptor activity	IBA
GO:0033038	Function	Bitter taste receptor activity	IDA	16720576, 20022913
GO:0033038	Function	Bitter taste receptor activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0050909	Process	Sensory perception of taste	IEA
GO:0060170	Component	Ciliary membrane	IEA

Other IDs

• MIM: 612668
• HGNC: 18875
• e!Ensembl: ENSG00000255374

Protein

• UniProt ID: P59537
• Protein name: Taste receptor type 2 member 43 (T2R43) (Taste receptor type 2 member 52) (T2R52)
• Protein function: Gustducin-coupled receptor immplicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the sulfonyl amide sweeteners sacc
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05296	TAS2R	1 → 298	Taste receptor protein (TAS2R)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Expressed in airway epithelia. {ECO:0000269|PubMed:19628819}.
• Sequence:

  MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW
  VLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLH
  LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVT
  MVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI
  YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYW
  VKGEKTSSP

• Sequence length: 309

Pathways

KEGG:

Taste transduction

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)