Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	259289
Gene name Gene Name - the full gene name approved by the HGNC.	Taste 2 receptor member 43
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TAS2R43
Synonyms (NCBI Gene) Gene synonyms aliases	T2R43, T2R52
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	TAS2R43 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway (Conte et al., 2002 [PubMed 12584440]). For furth

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	16720576, 20022913
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IC	16720576
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008527	Function	Taste receptor activity	IDA	16720576
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IC	16720576, 20022913
GO:0016020	Component	Membrane	IEA
GO:0031514	Component	Motile cilium	IDA	19628819
GO:0033038	Function	Bitter taste receptor activity	IBA
GO:0033038	Function	Bitter taste receptor activity	IDA	16720576, 20022913
GO:0033038	Function	Bitter taste receptor activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0050909	Process	Sensory perception of taste	IEA
GO:0060170	Component	Ciliary membrane	IEA

MIM	HGNC	e!Ensembl
612668	18875	ENSG00000255374

Protein

UniProt ID

P59537

Protein name

Taste receptor type 2 member 43 (T2R43) (Taste receptor type 2 member 52) (T2R52)

Protein function

Gustducin-coupled receptor immplicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the sulfonyl amide sweeteners sacc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05296	TAS2R	1 → 298	Taste receptor protein (TAS2R)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Expressed in airway epithelia. {ECO:0000269|PubMed:19628819}.

Sequence

MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW
VLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLH
LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVT
MVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI
YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYW
VKGEKTSSP

Sequence length

309

Interactions

View interactions

	KEGG		Reactome
	Taste transduction		G alpha (i) signalling events Class C/3 (Metabotropic glutamate/pheromone receptors)

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypertension	Idiopathic intracranial hypertension	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Balkan Nephropathy	Associate	23050764

TAS2R43 (taste 2 receptor member 43)