RMP64 (ribonuclease MRP subunit p64)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25871
Gene name Gene Name - the full gene name approved by the HGNC.
Ribonuclease MRP subunit p64
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RMP64
Synonyms (NCBI Gene) Gene synonyms aliases
ANXD3, C3orf17, NEPRO, NET17
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT442141 hsa-miR-1255b-2-3p PAR-CLIP 22100165
MIRT442140 hsa-miR-3614-5p PAR-CLIP 22100165
MIRT442139 hsa-miR-4650-3p PAR-CLIP 22100165
MIRT442138 hsa-miR-3529-5p PAR-CLIP 22100165
MIRT442137 hsa-miR-379-5p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus ISS
GO:0005730 Component Nucleolus IEA
GO:0005730 Component Nucleolus ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617089 24496 ENSG00000163608
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6NW34
Protein name Nucleolus and neural progenitor protein
Protein function May play a role in cortex development as part of the Notch signaling pathway. Downstream of Notch may repress the expression of proneural genes and inhibit neuronal differentiation thereby maintaining neural progenitors. May also play a role in
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14780 DUF4477 12 → 202 Domain of unknown function (DUF4477) Family
Sequence 
MMAAVPPGLEPWNRVRIPKAGNRSAVTVQNPGAALDLCIAAVIKECHLVILSLKSQTLDA
ETDVLCAVLYSNHNRMGRHKPHLALKQVEQCLKRLKNMNLEGSIQDLFELFSSNENQPLT
TKVCVVPSQPVVELVLMKVLGACKLLLRLLDCCCKTFLLTVKHLGLQEFIILNLVMVGLV
SRLWVLYKGVLKRLILLYEPLFGLLQEVARIQPMPYFKDFTFPSDITEFLGQPYFEAFKK
KMPIAFAAKGINKLLNKLFLINEQSPRASEETLLGISKKAKQMKINVQNNVDLGQPVKNK
RVFKEESSEFDVRAFCNQLKHKATQETSFDFKCSQSRLKTTKYSSQKVIGTPHAKSFVQR
FREAESFTQLSEEIQMAVVWCRSKKLKAQAIFLGNKLLKSNRLKHLEAQGTSLPKKLECI
KTSICNHLLRGSGIKTSKHHLRQRRSQNKFLRRQRKPQRKLQSTLLREIQQFSQGTRKSA
TDTSAKWRLSHCTVHRTDLYPNSKQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSWTV
MQINKNSTSGTIKETDDIDDIFALMGV
Sequence length 567
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Anauxetic Dysplasia Anauxetic dysplasia 3 rs769447751 N/A