Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	25865
Gene name Gene Name - the full gene name approved by the HGNC.	Protein kinase D2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRKD2
Synonyms (NCBI Gene) Gene synonyms aliases	HSPC187, PKD2, nPKC-D2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	PKD2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It

Show/Hide all(60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004187	hsa-miR-197-3p	Microarray	16822819
MIRT639968	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT639967	hsa-miR-4438	HITS-CLIP	23824327
MIRT639959	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT639966	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT639965	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT639964	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT639963	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT639962	hsa-miR-4775	HITS-CLIP	23824327
MIRT639961	hsa-miR-5095	HITS-CLIP	23824327
MIRT639960	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT639959	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT639958	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT639957	hsa-miR-3149	HITS-CLIP	23824327
MIRT525119	hsa-miR-3654	PAR-CLIP	22012620
MIRT525118	hsa-miR-3690	PAR-CLIP	22012620
MIRT525117	hsa-miR-4254	PAR-CLIP	22012620
MIRT525116	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT525115	hsa-miR-378b	PAR-CLIP	22012620
MIRT525114	hsa-miR-378c	PAR-CLIP	22012620
MIRT525113	hsa-miR-378d	PAR-CLIP	22012620
MIRT525112	hsa-miR-378e	PAR-CLIP	22012620
MIRT525111	hsa-miR-378f	PAR-CLIP	22012620
MIRT525109	hsa-miR-378h	PAR-CLIP	22012620
MIRT525110	hsa-miR-378i	PAR-CLIP	22012620
MIRT525108	hsa-miR-422a	PAR-CLIP	22012620
MIRT525107	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT525106	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT525105	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT639968	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT639967	hsa-miR-4438	HITS-CLIP	23824327
MIRT639959	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT639966	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT639965	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT639964	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT639963	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT639962	hsa-miR-4775	HITS-CLIP	23824327
MIRT639961	hsa-miR-5095	HITS-CLIP	23824327
MIRT639960	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT639959	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT639958	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT639957	hsa-miR-3149	HITS-CLIP	23824327
MIRT525119	hsa-miR-3654	PAR-CLIP	22012620
MIRT525118	hsa-miR-3690	PAR-CLIP	22012620
MIRT525117	hsa-miR-4254	PAR-CLIP	22012620
MIRT525116	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT525115	hsa-miR-378b	PAR-CLIP	22012620
MIRT525114	hsa-miR-378c	PAR-CLIP	22012620
MIRT525113	hsa-miR-378d	PAR-CLIP	22012620
MIRT525112	hsa-miR-378e	PAR-CLIP	22012620
MIRT525111	hsa-miR-378f	PAR-CLIP	22012620
MIRT525109	hsa-miR-378h	PAR-CLIP	22012620
MIRT525110	hsa-miR-378i	PAR-CLIP	22012620
MIRT525108	hsa-miR-422a	PAR-CLIP	22012620
MIRT525107	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT525106	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT525105	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT2304097	hsa-miR-4446-5p	CLIP-seq
MIRT2304098	hsa-miR-4755-5p	CLIP-seq
MIRT2304099	hsa-miR-4786-3p	CLIP-seq

Show/Hide all(62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IGI	20497126
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	19001381
GO:0002250	Process	Adaptive immune response	IEA
GO:0004672	Function	Protein kinase activity	IDA	17077180
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18440775
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	28428613
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	11062248
GO:0004698	Function	Calcium-dependent protein kinase C activity	IEA
GO:0005080	Function	Protein kinase C binding	IPI	28428613
GO:0005515	Function	Protein binding	IPI	17962809, 19192391, 28514442
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	17077180
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	17077180
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	22228765
GO:0006468	Process	Protein phosphorylation	NAS	11062248
GO:0007155	Process	Cell adhesion	IEA
GO:0008219	Process	Cell death	IMP	17077180
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	19001381
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	18440775
GO:0018105	Process	Peptidyl-serine phosphorylation	IMP	28428613
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	28428613
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IMP	19001381
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	16928771
GO:0032793	Process	Positive regulation of CREB transcription factor activity	IGI	20497126
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IGI	20497126
GO:0035556	Process	Intracellular signal transduction	IMP	18059339, 18440775
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IGI	20497126
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	18059339, 18440775
GO:0038033	Process	Positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IGI	20497126
GO:0038033	Process	Positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IMP	18440775
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IGI	20497126
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	18440775
GO:0045743	Process	Positive regulation of fibroblast growth factor receptor signaling pathway	IMP	19001381
GO:0045766	Process	Positive regulation of angiogenesis	IGI	20497126
GO:0045766	Process	Positive regulation of angiogenesis	IMP	18440775, 19001381
GO:0045785	Process	Positive regulation of cell adhesion	IMP	17951978
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17077180
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18059339
GO:0046777	Process	Protein autophosphorylation	IDA	17077180
GO:0046777	Process	Protein autophosphorylation	TAS	21488147
GO:0046872	Function	Metal ion binding	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	18059339
GO:0050852	Process	T cell receptor signaling pathway	IDA	17077180
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	ISS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	19192391
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	15604256, 16928771, 28428613
GO:0061154	Process	Endothelial tube morphogenesis	TAS	21488147
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0089700	Process	Protein kinase D signaling	IBA	21873635
GO:0089700	Process	Protein kinase D signaling	IGI	20497126
GO:1901727	Process	Positive regulation of histone deacetylase activity	IGI	20497126
GO:1902533	Process	Positive regulation of intracellular signal transduction	IMP	18440775
GO:2000573	Process	Positive regulation of DNA biosynthetic process	ISS
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IMP	18440775

MIM	HGNC	e!Ensembl
607074	17293	ENSG00000105287

Protein

UniProt ID

Q9BZL6

Protein name

Serine/threonine-protein kinase D2 (EC 2.7.11.13) (nPKC-D2)

Protein function

Serine/threonine-protein kinase that converts transient diacylglycerol (DAG) signals into prolonged physiological effects downstream of PKC, and is involved in the regulation of cell proliferation via MAPK1/3 (ERK1/2) signaling, oxidative stress

PDB

2COA , 3BGM , 4NNX , 4NNY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00130	C1_1	139 → 191	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00130	C1_1	265 → 317	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00069	Pkinase	552 → 807	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11062248}.

Sequence

MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSS
SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALH
ASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGE
MPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQ
ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGA
IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

Sequence length

878

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Aldosterone synthesis and secretion Chemical carcinogenesis - reactive oxygen species		Sphingolipid de novo biosynthesis

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	19430480, 25751624
Gastric cancer	Gastric Adenocarcinoma	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	22190364

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	References	Source
Unknown
Nasopharyngeal carcinoma	Nasopharyngeal carcinoma	These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes.	20512145	ClinVar, CBGDA
Diabetes	Diabetes			GWAS
Lymphocytic Leukemia	Lymphocytic Leukemia			GWAS
Coronary artery disease	Coronary artery disease			GWAS
Sclerosing Cholangitis	Sclerosing Cholangitis			GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	30843621, 31492931
Aortic Aneurysm Abdominal	Associate	39895541
Cholangiocarcinoma	Associate	36231050
Diabetes Mellitus Type 1	Associate	22403184
Gastrointestinal Stromal Tumors	Associate	37616163
Glioblastoma	Associate	23562655, 34234410
Leukemia B Cell	Associate	20855867
Leukemia Lymphocytic Chronic B Cell	Associate	20855867
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26072332
Leukemia Myeloid	Associate	26241492
Leukemia Prolymphocytic T Cell	Associate	20553269
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	35499078
Neoplasms	Associate	30718593, 30843621, 31917403, 35961204
Osteoarthritis	Associate	37579195
Osteoarthritis Hip	Associate	37579195
Pancreatic Neoplasms	Associate	24336522
Pancreatitis	Associate	22403184
Salivary Gland Neoplasms	Associate	31917707

PRKD2 (protein kinase D2)