Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	25818
Gene name Gene Name - the full gene name approved by the HGNC.	Kallikrein related peptidase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KLK5
Synonyms (NCBI Gene) Gene synonyms aliases	KLK-L2, KLKL2, SCTE
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.41
Summary Summary of gene provided in NCBI Entrez Gene.	Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002803	Process	Positive regulation of antibacterial peptide production	IMP	17012259
GO:0004252	Function	Serine-type endopeptidase activity	EXP	16885167
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	16885167
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	11054574
GO:0005515	Function	Protein binding	IPI	19194479, 23629652, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IMP	17012259
GO:0005615	Component	Extracellular space	TAS	10608802
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	IMP	17012259
GO:0008233	Function	Peptidase activity	TAS	10608802
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	10514489
GO:0008544	Process	Epidermis development	TAS	10514489
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IBA
GO:0030141	Component	Secretory granule	IBA
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	16885167
GO:0051604	Process	Protein maturation	IBA
GO:0070268	Process	Cornification	TAS
GO:0097186	Process	Amelogenesis	IBA
GO:0097209	Component	Epidermal lamellar body	IDA	15675955

MIM	HGNC	e!Ensembl
605643	6366	ENSG00000167754

Protein

UniProt ID

Q9Y337

Protein name

Kallikrein-5 (EC 3.4.21.-) (Kallikrein-like protein 2) (KLK-L2) (Stratum corneum tryptic enzyme)

Protein function

May be involved in desquamation.

PDB

2PSX , 2PSY , 6QFE , 7U5B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	67 → 285	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in skin, breast, brain and testis. Expressed at the stratum granulosum of palmar skin. {ECO:0000269|PubMed:19190773}.

Sequence

MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

Sequence length

293

Interactions

View interactions

	Reactome
			Formation of the cornified envelope

KLK5 (kallikrein related peptidase 5)