KLK5 (kallikrein related peptidase 5)

Gene

• Entrez ID: 25818
• Gene name: Kallikrein related peptidase 5
• Gene symbol: KLK5
• Synonyms (NCBI Gene): KLK-L2, KLKL2, SCTE
• Chromosome: 19
• Chromosome location: 19q13.41
• Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002803	Process	Positive regulation of antibacterial peptide production	IMP	17012259
GO:0004252	Function	Serine-type endopeptidase activity	EXP	16885167
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	16885167
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	NAS	11054574
GO:0005515	Function	Protein binding	IPI	19194479, 23629652, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IMP	17012259
GO:0005615	Component	Extracellular space	TAS	10608802
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	IMP	17012259
GO:0008233	Function	Peptidase activity	TAS	10608802
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	10514489
GO:0008544	Process	Epidermis development	TAS	10514489
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IBA
GO:0030141	Component	Secretory granule	IBA
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	16885167
GO:0051604	Process	Protein maturation	IBA
GO:0070268	Process	Cornification	TAS
GO:0097186	Process	Amelogenesis	IBA
GO:0097209	Component	Epidermal lamellar body	IDA	15675955

Other IDs

• MIM: 605643
• HGNC: 6366
• e!Ensembl: ENSG00000167754

Protein

• UniProt ID: Q9Y337
• Protein name: Kallikrein-5 (EC 3.4.21.-) (Kallikrein-like protein 2) (KLK-L2) (Stratum corneum tryptic enzyme)
• Protein function: May be involved in desquamation.
• PDB: 2PSX, 2PSY, 6QFE, 7U5B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	67 → 285	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in skin, breast, brain and testis. Expressed at the stratum granulosum of palmar skin. {ECO:0000269|PubMed:19190773}.
• Sequence:

  MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
  DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
  YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
  AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
  CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

• Sequence length: 293

Pathways

Reactome:

Formation of the cornified envelope