TAFA5 (TAFA chemokine like family member 5)

Gene

• Entrez ID: 25817
• Gene name: TAFA chemokine like family member 5
• Gene symbol: TAFA5
• Synonyms (NCBI Gene): FAM19A5, QLLK5208, TAFA-5, UNQ5208
• Chromosome: 22
• Chromosome location: 22q13.32
• Summary: This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IBA
GO:0001664	Function	G protein-coupled receptor binding	IPI	29453251
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	29453251
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	29453251
GO:0048018	Function	Receptor ligand activity	IBA
GO:0048018	Function	Receptor ligand activity	IPI	29453251
GO:0061044	Process	Negative regulation of vascular wound healing	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IDA	29453251
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	29453251

Other IDs

• MIM: 617499
• HGNC: 21592
• e!Ensembl: ENSG00000219438

Protein

• UniProt ID: Q7Z5A7
• Protein name: Chemokine-like protein TAFA-5
• Protein function: Acts as a chemokine-like protein by regulating cell proliferation and migration through activation of G protein-coupled receptors (GPCRs), such as S1PR2 and FPR2 (By similarity). Stimulates chemotactic migration of macrophages mediated by the MA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12020	TAFA	42 → 131	TAFA family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the subcutaneous and perirenal adipose tissue (at protein level) (PubMed:29453251). Highly expressed in adipose tissue with moderate expression in the brain and ovary (PubMed:29453251). Isoform 2: Brain-specific (PubMed:15
• Sequence:

  MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT
  IARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCT
  QPGGRIKTTTVS

• Sequence length: 132