BAMBI (BMP and activin membrane bound inhibitor)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 25805
Gene name BMP and activin membrane bound inhibitor
Gene symbol BAMBI
Synonyms (NCBI Gene)
NMA
Chromosome 10
Chromosome location 10p12.1
Summary This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encode
miRNA miRNA information provided by mirtarbase database.
695
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (695)
miRTarBase ID miRNA Experiments Reference
MIRT004121 hsa-miR-20b-5p Luciferase reporter assayqRT-PCR 21042576
MIRT004121 hsa-miR-20b-5p Luciferase reporter assayqRT-PCR 21042576
MIRT006755 hsa-miR-20a-5p Luciferase reporter assay 21743293
MIRT006755 hsa-miR-20a-5p Luciferase reporter assay 21743293
MIRT016041 hsa-miR-374b-5p Sequencing 20371350
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (4)
Transcription factor Regulation Reference
FOXF2 Activation 19562724
HDAC1 Repression 24448807
SMAD3 Activation 15240101
SMAD4 Activation 15240101
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (22)
GO ID Ontology Definition Evidence Reference
GO:0005109 Function Frizzled binding IBA
GO:0005109 Function Frizzled binding IPI 18838381
GO:0005114 Function Type II transforming growth factor beta receptor binding TAS 18756595
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IDA 10942595, 18756595
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
604444 30251 ENSG00000095739
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13145
Protein name BMP and activin membrane-bound inhibitor homolog (Non-metastatic gene A protein) (Putative transmembrane protein NMA)
Protein function Negatively regulates TGF-beta signaling.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06211 BAMBI 4 → 111 BMP and activin membrane-bound inhibitor (BAMBI) N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
Sequence 
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
SNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEA
SGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
KRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSND
KILSLVHWGMYSGHGKLEFV
Sequence length 260
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Wnt signaling pathway
TGF-beta signaling pathway 		  Downregulation of TGF-beta receptor signaling