Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
25805
Gene name Gene Name - the full gene name approved by the HGNC.
BMP and activin membrane bound inhibitor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BAMBI
Synonyms (NCBI Gene) Gene synonyms aliases
NMA
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encode
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004121 hsa-miR-20b-5p Luciferase reporter assay, qRT-PCR 21042576
MIRT004121 hsa-miR-20b-5p Luciferase reporter assay, qRT-PCR 21042576
MIRT006755 hsa-miR-20a-5p Luciferase reporter assay 21743293
MIRT006755 hsa-miR-20a-5p Luciferase reporter assay 21743293
MIRT016041 hsa-miR-374b-5p Sequencing 20371350
Transcription factors
Transcription factor Regulation Reference
FOXF2 Activation 19562724
HDAC1 Repression 24448807
SMAD3 Activation 15240101
SMAD4 Activation 15240101
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005109 Function Frizzled binding IBA 21873635
GO:0005109 Function Frizzled binding IPI 18838381
GO:0005114 Function Type II transforming growth factor beta receptor binding TAS 18756595
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IDA 10942595, 18756595
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604444 30251 ENSG00000095739
Protein
UniProt ID Q13145
Protein name BMP and activin membrane-bound inhibitor homolog (Non-metastatic gene A protein) (Putative transmembrane protein NMA)
Protein function Negatively regulates TGF-beta signaling.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06211 BAMBI 4 111 BMP and activin membrane-bound inhibitor (BAMBI) N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
Sequence
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
SNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHD
VLSPPRGEA
SGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
KRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSND
KILSLVHWGMYSGHGKLEFV
Sequence length 260
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Wnt signaling pathway
TGF-beta signaling pathway
  Downregulation of TGF-beta receptor signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure 29394407 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 29394407 ClinVar
Myocardial infarction Myocardial Failure 29394407 ClinVar
Preeclampsia Preeclampsia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Anemia Diamond Blackfan Associate 26258650
Aortic Valve Stenosis Associate 33963260
Arthritis Associate 30320351
Atrioventricular Block Associate 33963260
Bone Diseases Associate 16007344
Carcinoma Hepatocellular Associate 36999621
Chemical and Drug Induced Liver Injury Associate 24448807, 30097701
Colorectal Neoplasms Associate 18756595, 18838381, 33898197
Corneal Endothelial Cell Loss Associate 35603423
COVID 19 Associate 35231079