Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	25803
Gene name	SAM pointed domain containing ETS transcription factor
Gene symbol	SPDEF
Synonyms (NCBI Gene)	PDEFbA375E1.3
Chromosome	6
Chromosome location	6p21.31
Summary	The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expre

167

Show/Hide all (167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005337	hsa-miR-204-5p	Luciferase reporter assayWestern blot	18922924
MIRT005338	hsa-miR-510-5p	Luciferase reporter assayWestern blot	18922924
MIRT018698	hsa-miR-335-5p	Microarray	18185580
MIRT439144	hsa-let-7c-5p	3'LIFE	25074381
MIRT439144	hsa-let-7c-5p	3'LIFE	25074381
MIRT1383426	hsa-miR-1207-5p	CLIP-seq
MIRT1383427	hsa-miR-1251	CLIP-seq
MIRT1383428	hsa-miR-1266	CLIP-seq
MIRT1383429	hsa-miR-146b-3p	CLIP-seq
MIRT1383430	hsa-miR-15a	CLIP-seq
MIRT1383431	hsa-miR-15b	CLIP-seq
MIRT1383432	hsa-miR-16	CLIP-seq
MIRT1383433	hsa-miR-1827	CLIP-seq
MIRT1383434	hsa-miR-195	CLIP-seq
MIRT1383435	hsa-miR-2110	CLIP-seq
MIRT1383436	hsa-miR-2117	CLIP-seq
MIRT1383437	hsa-miR-2278	CLIP-seq
MIRT1383438	hsa-miR-2861	CLIP-seq
MIRT1383439	hsa-miR-3064-5p	CLIP-seq
MIRT1383440	hsa-miR-3127-5p	CLIP-seq
MIRT1383441	hsa-miR-3130-3p	CLIP-seq
MIRT1383442	hsa-miR-3147	CLIP-seq
MIRT1383443	hsa-miR-3150a-3p	CLIP-seq
MIRT1383444	hsa-miR-3175	CLIP-seq
MIRT1383445	hsa-miR-325	CLIP-seq
MIRT1383446	hsa-miR-339-5p	CLIP-seq
MIRT1383447	hsa-miR-342-5p	CLIP-seq
MIRT1383448	hsa-miR-361-3p	CLIP-seq
MIRT1383449	hsa-miR-3664-3p	CLIP-seq
MIRT1383450	hsa-miR-3679-3p	CLIP-seq
MIRT1383451	hsa-miR-3918	CLIP-seq
MIRT1383452	hsa-miR-424	CLIP-seq
MIRT1383453	hsa-miR-4277	CLIP-seq
MIRT1383454	hsa-miR-4287	CLIP-seq
MIRT1383455	hsa-miR-4421	CLIP-seq
MIRT1383456	hsa-miR-4425	CLIP-seq
MIRT1383457	hsa-miR-4436b-3p	CLIP-seq
MIRT1383458	hsa-miR-4446-5p	CLIP-seq
MIRT1383459	hsa-miR-4468	CLIP-seq
MIRT1383460	hsa-miR-4469	CLIP-seq
MIRT1383461	hsa-miR-4494	CLIP-seq
MIRT1383462	hsa-miR-4512	CLIP-seq
MIRT1383463	hsa-miR-4518	CLIP-seq
MIRT1383464	hsa-miR-4532	CLIP-seq
MIRT1383465	hsa-miR-4649-3p	CLIP-seq
MIRT1383466	hsa-miR-4664-5p	CLIP-seq
MIRT1383467	hsa-miR-4684-5p	CLIP-seq
MIRT1383468	hsa-miR-4685-3p	CLIP-seq
MIRT1383469	hsa-miR-4763-3p	CLIP-seq
MIRT1383470	hsa-miR-4771	CLIP-seq
MIRT1383471	hsa-miR-4795-3p	CLIP-seq
MIRT1383472	hsa-miR-483-3p	CLIP-seq
MIRT1383473	hsa-miR-497	CLIP-seq
MIRT1383474	hsa-miR-510	CLIP-seq
MIRT1383475	hsa-miR-604	CLIP-seq
MIRT1383476	hsa-miR-628-3p	CLIP-seq
MIRT1383477	hsa-miR-647	CLIP-seq
MIRT1383478	hsa-miR-922	CLIP-seq
MIRT1383479	hsa-miR-939	CLIP-seq
MIRT1383480	hsa-miR-940	CLIP-seq
MIRT2114663	hsa-miR-1237	CLIP-seq
MIRT2114664	hsa-miR-1254	CLIP-seq
MIRT1383428	hsa-miR-1266	CLIP-seq
MIRT2114665	hsa-miR-1269	CLIP-seq
MIRT2114666	hsa-miR-1269b	CLIP-seq
MIRT2114667	hsa-miR-1288	CLIP-seq
MIRT2114668	hsa-miR-1587	CLIP-seq
MIRT1383439	hsa-miR-3064-5p	CLIP-seq
MIRT2114669	hsa-miR-3116	CLIP-seq
MIRT2114670	hsa-miR-3137	CLIP-seq
MIRT2114671	hsa-miR-3182	CLIP-seq
MIRT2114672	hsa-miR-3686	CLIP-seq
MIRT2114673	hsa-miR-3690	CLIP-seq
MIRT2114674	hsa-miR-378	CLIP-seq
MIRT2114675	hsa-miR-378b	CLIP-seq
MIRT2114676	hsa-miR-378c	CLIP-seq
MIRT2114677	hsa-miR-378d	CLIP-seq
MIRT2114678	hsa-miR-378e	CLIP-seq
MIRT2114679	hsa-miR-378f	CLIP-seq
MIRT2114680	hsa-miR-378h	CLIP-seq
MIRT2114681	hsa-miR-378i	CLIP-seq
MIRT2114682	hsa-miR-422a	CLIP-seq
MIRT2114683	hsa-miR-4437	CLIP-seq
MIRT1383459	hsa-miR-4468	CLIP-seq
MIRT2114684	hsa-miR-4515	CLIP-seq
MIRT1383463	hsa-miR-4518	CLIP-seq
MIRT1383464	hsa-miR-4532	CLIP-seq
MIRT2114685	hsa-miR-4674	CLIP-seq
MIRT2114686	hsa-miR-4731-5p	CLIP-seq
MIRT2114687	hsa-miR-4740-5p	CLIP-seq
MIRT1383471	hsa-miR-4795-3p	CLIP-seq
MIRT1383472	hsa-miR-483-3p	CLIP-seq
MIRT1383474	hsa-miR-510	CLIP-seq
MIRT1383475	hsa-miR-604	CLIP-seq
MIRT2114688	hsa-miR-635	CLIP-seq
MIRT1383477	hsa-miR-647	CLIP-seq
MIRT2114689	hsa-miR-663b	CLIP-seq
MIRT2114690	hsa-miR-760	CLIP-seq
MIRT2114691	hsa-miR-938	CLIP-seq
MIRT2337516	hsa-miR-1207-3p	CLIP-seq
MIRT1383426	hsa-miR-1207-5p	CLIP-seq
MIRT2114663	hsa-miR-1237	CLIP-seq
MIRT2114664	hsa-miR-1254	CLIP-seq
MIRT2114665	hsa-miR-1269	CLIP-seq
MIRT2114666	hsa-miR-1269b	CLIP-seq
MIRT2114667	hsa-miR-1288	CLIP-seq
MIRT2337517	hsa-miR-1299	CLIP-seq
MIRT1383429	hsa-miR-146b-3p	CLIP-seq
MIRT1383433	hsa-miR-1827	CLIP-seq
MIRT2337518	hsa-miR-1909	CLIP-seq
MIRT1383438	hsa-miR-2861	CLIP-seq
MIRT2337519	hsa-miR-298	CLIP-seq
MIRT2114669	hsa-miR-3116	CLIP-seq
MIRT2114670	hsa-miR-3137	CLIP-seq
MIRT2337520	hsa-miR-3150b-3p	CLIP-seq
MIRT2114671	hsa-miR-3182	CLIP-seq
MIRT2337521	hsa-miR-3194-3p	CLIP-seq
MIRT1383446	hsa-miR-339-5p	CLIP-seq
MIRT2337522	hsa-miR-3612	CLIP-seq
MIRT2114672	hsa-miR-3686	CLIP-seq
MIRT2337523	hsa-miR-3689a-3p	CLIP-seq
MIRT2337524	hsa-miR-3689c	CLIP-seq
MIRT2114673	hsa-miR-3690	CLIP-seq
MIRT2114674	hsa-miR-378	CLIP-seq
MIRT2114675	hsa-miR-378b	CLIP-seq
MIRT2114676	hsa-miR-378c	CLIP-seq
MIRT2114677	hsa-miR-378d	CLIP-seq
MIRT2114678	hsa-miR-378e	CLIP-seq
MIRT2114679	hsa-miR-378f	CLIP-seq
MIRT2114680	hsa-miR-378h	CLIP-seq
MIRT2114681	hsa-miR-378i	CLIP-seq
MIRT2337525	hsa-miR-3909	CLIP-seq
MIRT2337526	hsa-miR-3934	CLIP-seq
MIRT2114682	hsa-miR-422a	CLIP-seq
MIRT2337527	hsa-miR-4257	CLIP-seq
MIRT1383454	hsa-miR-4287	CLIP-seq
MIRT1383455	hsa-miR-4421	CLIP-seq
MIRT1383459	hsa-miR-4468	CLIP-seq
MIRT1383460	hsa-miR-4469	CLIP-seq
MIRT2337528	hsa-miR-4493	CLIP-seq
MIRT2114684	hsa-miR-4515	CLIP-seq
MIRT2337529	hsa-miR-4525	CLIP-seq
MIRT2337530	hsa-miR-4534	CLIP-seq
MIRT1383468	hsa-miR-4685-3p	CLIP-seq
MIRT2337531	hsa-miR-4685-5p	CLIP-seq
MIRT2337532	hsa-miR-4689	CLIP-seq
MIRT2337533	hsa-miR-4691-5p	CLIP-seq
MIRT2337534	hsa-miR-4716-3p	CLIP-seq
MIRT2337535	hsa-miR-4728-5p	CLIP-seq
MIRT2114686	hsa-miR-4731-5p	CLIP-seq
MIRT2114687	hsa-miR-4740-5p	CLIP-seq
MIRT2337536	hsa-miR-4751	CLIP-seq
MIRT1383469	hsa-miR-4763-3p	CLIP-seq
MIRT2337537	hsa-miR-4784	CLIP-seq
MIRT2337538	hsa-miR-544b	CLIP-seq
MIRT2337539	hsa-miR-615-5p	CLIP-seq
MIRT2337540	hsa-miR-642a	CLIP-seq
MIRT2337541	hsa-miR-646	CLIP-seq
MIRT2337542	hsa-miR-650	CLIP-seq
MIRT2114689	hsa-miR-663b	CLIP-seq
MIRT2337543	hsa-miR-711	CLIP-seq
MIRT2114690	hsa-miR-760	CLIP-seq
MIRT2337544	hsa-miR-767-3p	CLIP-seq
MIRT2337545	hsa-miR-875-3p	CLIP-seq
MIRT2114691	hsa-miR-938	CLIP-seq
MIRT1383479	hsa-miR-939	CLIP-seq
MIRT1383480	hsa-miR-940	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	21656828
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0002068	Process	Glandular epithelial cell development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0010454	Process	Negative regulation of cell fate commitment	IEA
GO:0010455	Process	Positive regulation of cell fate commitment	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21656828
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0060480	Process	Lung goblet cell differentiation	IEA
GO:0060576	Process	Intestinal epithelial cell development	IEA
GO:0072148	Process	Epithelial cell fate commitment	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
608144	17257	ENSG00000124664

O95238

Protein name

SAM pointed domain-containing Ets transcription factor (Prostate epithelium-specific Ets transcription factor) (Prostate-specific Ets) (Prostate-derived Ets factor)

Protein function

May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a tran

PDB

1YO5 , 2DKX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02198	SAM_PNT	131 → 213	Sterile alpha motif (SAM)/Pointed domain	Domain
PF00178	Ets	250 → 332	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a very restricted set of primarily hormone-regulated epithelial tissues with particularly high expression in the prostate gland. Significantly lower expression is seen in other hormone regulated tissues such as mammary gla

Sequence

MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYL
SYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLE
QVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAG
KELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEV
DSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAM
NYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

Sequence length

335

Interactions

View interactions

SPDEF (SAM pointed domain containing ETS transcription factor)