Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
256764
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 72
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR72
Synonyms (NCBI Gene) Gene synonyms aliases
AI2A3
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with eight WD-40 repeats. Mutations in this gene have been associated with amelogenesis imperfecta hypomaturation type 2A3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs143816093 C>G,T Pathogenic Coding sequence variant, stop gained, missense variant, genic upstream transcript variant, non coding transcript variant
rs267607178 G>A,C Pathogenic Genic upstream transcript variant, missense variant, coding sequence variant, non coding transcript variant, stop gained
rs557128345 G>A Pathogenic Stop gained, coding sequence variant, non coding transcript variant, genic upstream transcript variant
rs606231351 T>- Pathogenic Genic upstream transcript variant, frameshift variant, coding sequence variant, non coding transcript variant
rs606231462 AT>- Pathogenic Genic upstream transcript variant, frameshift variant, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT515415 hsa-miR-8485 HITS-CLIP 21572407
MIRT515414 hsa-miR-329-3p HITS-CLIP 21572407
MIRT515413 hsa-miR-362-3p HITS-CLIP 21572407
MIRT515412 hsa-miR-603 HITS-CLIP 21572407
MIRT515411 hsa-miR-4789-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 20938048
GO:0031214 Process Biomineral tissue development IEA
GO:0031410 Component Cytoplasmic vesicle IEA
GO:0072659 Process Protein localization to plasma membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613214 26790 ENSG00000166415
Protein
UniProt ID Q3MJ13
Protein name WD repeat-containing protein 72
Protein function Plays a major role in formation of tooth enamel (PubMed:19853237, PubMed:25008349). Specifically required during the maturation phase of amelogenesis for normal formation of the enamel matrix and clearance of enamel proteins. May be involved in
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 452 495 WD domain, G-beta repeat Repeat
PF00400 WD40 547 585 WD domain, G-beta repeat Repeat
Sequence
MRTSLQAVALWGQKAPPHSITAIMITDDQRTIVTGSQEGQLCLWNLSHELKISAKELLFG
HSASVTCLARARDFSKQPYIVSAAENGEMCVWNVTNGQCMEKATLPYRHTAICYYHCSFR
MTGEGWLLCCGEYQDVLIIDAKTLAVVHSFRSSQFPDWINCMCIVHSMRIQEDSLLVVSV
AGELKVWDLSSSINSIQEKQDVYEKESKFLESLNCQTIRFCTYTERLLLVVFSKCWKVYD
YCDFSLLLTEVSRNGQFFAGGEVIAAHRILIWTEDGHSYIYQLLNSGLSKSIYPADGRVL
KETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVS
KFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYFSGLKDGAGTAVVTSSEYIPSLDKLI
CGCEDGTIIITQALNAAKARLLEGGSLVKDSPPHKVLKGHHQSVTSLLYPHGLSSKLDQS
WMLSGDLDSCVILWD
IFTEEILHKFFLEAGPVTSLLMSPEKFKLRGEQIICCVCGDHSVA
LLHLEGKSCLLHARKHLFPVRMIKWHPVENFLIVGCADDSVYIWEIETGTLERHETGERA
RIILNCCDDSQLVKSVLPIASETLKHKSIEQRSSSPYQLGPLPCPGLQVESSCKVTDAKF
CPRPFNVLPVKTKWSNVGFHILLFDLENLVELLLPTPLSDVDSSSSFYGGEVLRRAKSTV
EKKTLTLRKSKTACGPLSAEALAKPITESLAQGDNTIKFSEENDGIKRQKKMKISKKMQP
KPSRKVDASLTIDTAKLFLSCLLPWGVDKDLDYLCIKHLNILKLQGPISLGISLNEDNFS
LMLPGWDLCNSGMIKDYSGVNLFSRKVLDLSDKYTATLPNQVGIPRGLENNCDSLRESDT
IVYLLSRLFLVNKLVNMPLELACRVGSSFRMESIHNKMRGAGNDILNMSSFYSCLRNGKN
ESHVPEADLSLLKLISCWRDQSVQVTEAIQAVLLAEVQQHMKSLGKIPVNSQPVSMAENG
NCEMKQMLPKLEWTEELELQCVRNTLPLQTPVSPVKHDSNSNSANFQDVEDMPDRCALEE
SESPGEPRHHSWIAKVCPCKVS
Sequence length 1102
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Amelogenesis imperfecta amelogenesis imperfecta rs770804941 N/A
Amelogenesis Imperfecta Amelogenesis imperfecta hypomaturation type 2A3 rs770804941, rs557128345, rs267607178, rs143816093, rs606231351, rs606231462 N/A
Renal Tubular Acidosis Renal tubular acidosis, distal, 4, with hemolytic anemia rs768446132 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Hyperuricemia Hyperuricemia N/A N/A GWAS
Hypogonadism Hypogonadism N/A N/A GWAS
Kidney Disease Chronic kidney disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Associate 30779877
Acidosis Renal Tubular Associate 30779877
Amelogenesis Imperfecta Associate 20938048, 21196691, 21597265, 22243262, 30779877, 31959358, 35181734
Amelogenesis Imperfecta hypomaturation type Associate 19853237, 20938048, 21196691
Amelogenesis Imperfecta Hypomaturation Type Iia3 Associate 30779877
Carcinoma Non Small Cell Lung Associate 37197572
Carcinoma Renal Cell Associate 33234734, 38048211
Colorectal Neoplasms Associate 32749190, 37158531
Developmental Defects of Enamel Associate 35181734
Diabetic Nephropathies Associate 30552240