Gene Gene information from NCBI Gene database.
Entrez ID 255488
Gene name Ring finger protein 144B
Gene symbol RNF144B
Synonyms (NCBI Gene)
IBRDC2PIR2bA528A10.3p53RFP
Chromosome 6
Chromosome location 6p22.3
miRNA miRNA information provided by mirtarbase database.
652
miRTarBase ID miRNA Experiments Reference
MIRT022046 hsa-miR-128-3p Microarray 17612493
MIRT022961 hsa-miR-124-3p Microarray 18668037
MIRT027180 hsa-miR-103a-3p Sequencing 20371350
MIRT031928 hsa-miR-16-5p Sequencing 20371350
MIRT700141 hsa-miR-6750-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IBA
GO:0000151 Component Ubiquitin ligase complex IC 12853982
GO:0004842 Function Ubiquitin-protein transferase activity IDA 12853982
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 12853982, 16427630, 19549727, 19690564, 20300062, 20615966
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618869 21578 ENSG00000137393
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z419
Protein name E3 ubiquitin-protein ligase RNF144B (EC 2.3.2.31) (IBR domain-containing protein 2) (RING finger protein 144B) (p53-inducible RING finger protein)
Protein function E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degrad
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01485 IBR 101 166 IBR domain, a half RING-finger domain Domain
PF01485 IBR 178 240 IBR domain, a half RING-finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, with lowest levels in brain and thymus, and highest levels detectable in heart, ovary and testis. {ECO:0000269|PubMed:16427630, ECO:0000269|PubMed:20300062}.
Sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQY
MQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTW
CPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSC
RDSQPIVLPTEHRA
LFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPC

RNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDP
STT
Sequence length 303
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation