Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
255488
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 144B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF144B
Synonyms (NCBI Gene) Gene synonyms aliases
IBRDC2, PIR2, bA528A10.3, p53RFP
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022046 hsa-miR-128-3p Microarray 17612493
MIRT022961 hsa-miR-124-3p Microarray 18668037
MIRT027180 hsa-miR-103a-3p Sequencing 20371350
MIRT031928 hsa-miR-16-5p Sequencing 20371350
MIRT700141 hsa-miR-6750-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IBA 21873635
GO:0000151 Component Ubiquitin ligase complex IC 12853982
GO:0000209 Process Protein polyubiquitination IBA 21873635
GO:0000209 Process Protein polyubiquitination TAS
GO:0004842 Function Ubiquitin-protein transferase activity IDA 12853982
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618869 21578 ENSG00000137393
Protein
UniProt ID Q7Z419
Protein name E3 ubiquitin-protein ligase RNF144B (EC 2.3.2.31) (IBR domain-containing protein 2) (RING finger protein 144B) (p53-inducible RING finger protein)
Protein function E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degrad
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01485 IBR 101 166 IBR domain, a half RING-finger domain Domain
PF01485 IBR 178 240 IBR domain, a half RING-finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, with lowest levels in brain and thymus, and highest levels detectable in heart, ovary and testis. {ECO:0000269|PubMed:16427630, ECO:0000269|PubMed:20300062}.
Sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQY
MQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTW
CPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSC
RDSQPIVLPTEHRA
LFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPC

RNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDP
STT
Sequence length 303
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Endometrial carcinoma Endometrial Carcinoma rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077
View all (247 more)
29724995
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34580602, 35820682
Endometrial Neoplasms Associate 29724995
Endometriosis Associate 23472165
Inflammation Associate 34580602