Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
253943
Gene name Gene Name - the full gene name approved by the HGNC.
YTH N6-methyladenosine RNA binding protein F3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
YTHDF3
Synonyms (NCBI Gene) Gene synonyms aliases
DF3
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the YTH (YT521-B homology) domain protein family. The YTH domain is common in eukaryotes, is often found in the middle of the protein sequence, and may function in binding to RNA. Alternative splicing results in multiple tran
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT720076 hsa-miR-137 HITS-CLIP 19536157
MIRT720075 hsa-miR-6865-3p HITS-CLIP 19536157
MIRT720074 hsa-miR-3620-3p HITS-CLIP 19536157
MIRT720073 hsa-miR-6802-3p HITS-CLIP 19536157
MIRT720071 hsa-miR-5096 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IDA 32492408
GO:0000932 Component P-body IEA
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IDA 32194978
GO:0003723 Function RNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618669 26465 ENSG00000185728
Protein
UniProt ID Q7Z739
Protein name YTH domain-containing family protein 3 (DF3)
Protein function Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, and regulates their stability (PubMed:28106072, PubMed:28106076, PubMed:28281539, PubMed:32492408). M6A is a modification present at internal sites of mRNAs and some non
PDB 6ZOT , 8BS5 , 8BS6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04146 YTH 416 491 YT521-B-like domain Domain
PF04146 YTH 488 551 YT521-B-like domain Domain
Sequence
MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSY
YAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLG
QHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSK
VPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNSVPPVSSAAPKPTSWAA
IARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTI
IQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQLQNRWVAPRNR
GAGFNQNNGAGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFI
IKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMK
SVVDYNA
YAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPL
EKAKQVLKIIA
TFKHTTSIFDDFAHYEKRQEEEEAMRRERNRNKQ
Sequence length 585
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 35569444
Adenocarcinoma of Lung Associate 34497675
Breast Neoplasms Associate 34952600, 37736788
Carcinoma Hepatocellular Stimulate 32631107
Carcinoma Hepatocellular Associate 34747720, 35963644
Cardiomyopathies Associate 37041267
Colonic Neoplasms Associate 32596399
Colorectal Neoplasms Associate 37194014
Coronary Artery Disease Associate 38098098
Crohn Disease Associate 36595818