Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	253012
Gene name Gene Name - the full gene name approved by the HGNC.	HEPACAM family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HEPACAM2
Synonyms (NCBI Gene) Gene synonyms aliases	MIKI
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein related to the immunoglobulin superfamily that plays a role in mitosis. Knockdown of this gene results in prometaphase arrest, abnormal nuclear morphology and apoptosis. Poly(ADP-ribosylation) of the encoded protein promotes it

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments
MIRT1044215	hsa-miR-1267	CLIP-seq
MIRT1044216	hsa-miR-3617	CLIP-seq
MIRT1044217	hsa-miR-4289	CLIP-seq
MIRT1044218	hsa-miR-4652-3p	CLIP-seq
MIRT1044219	hsa-miR-4684-3p	CLIP-seq
MIRT1044220	hsa-miR-4728-3p	CLIP-seq
MIRT1044221	hsa-miR-548ac	CLIP-seq
MIRT1044222	hsa-miR-548d-3p	CLIP-seq
MIRT1044223	hsa-miR-548z	CLIP-seq
MIRT1044224	hsa-miR-641	CLIP-seq
MIRT1044225	hsa-miR-3978	CLIP-seq
MIRT1044226	hsa-miR-4662a-3p	CLIP-seq
MIRT1921637	hsa-miR-4310	CLIP-seq
MIRT1921638	hsa-miR-4713-5p	CLIP-seq
MIRT1921637	hsa-miR-4310	CLIP-seq
MIRT1921638	hsa-miR-4713-5p	CLIP-seq
MIRT2241902	hsa-miR-3692	CLIP-seq
MIRT2241903	hsa-miR-452	CLIP-seq
MIRT2241904	hsa-miR-4676-3p	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	22864114
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	22864114
GO:0005794	Component	Golgi apparatus	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	22864114
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IBA
GO:0005819	Component	Spindle	IDA	22864114
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007098	Process	Centrosome cycle	IBA
GO:0007098	Process	Centrosome cycle	IMP	22864114
GO:0016020	Component	Membrane	IEA
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA	22864114
GO:0030496	Component	Midbody	IEA
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IDA

MIM	HGNC	e!Ensembl
614133	27364	ENSG00000188175

Protein

UniProt ID

A8MVW5

Protein name

HEPACAM family member 2 (Mitotic kinetics regulator)

Protein function

Required during prometaphase for centrosome maturation. Following poly-ADP-ribosylation (PARsylation) by TNKS, translocates from the Golgi apparatus to mitotic centrosomes and plays a key role in the formation of robust microtubules for prompt m

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	148 → 223		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:19358830}.

Sequence

MGQDAFMEPFGDTLGVFQCKIYLLLFGACSGLKVTVPSHTVHGVRGQALYLPVHYGFHTP
ASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNY
IVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAY
QWLKNGRPVHTSSTYSFSPQNNTLHIAPVTKEDIGNYSCLVRNPVSEMESDIIMPIIYYG
PYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRRTDNTTYIIKHGPRLE
VASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLSPLASITGISL
FLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDV
SGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE

Sequence length

462

Interactions

View interactions

HEPACAM2 (HEPACAM family member 2)