HEPACAM2 (HEPACAM family member 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
253012
Gene name Gene Name - the full gene name approved by the HGNC.
HEPACAM family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HEPACAM2
Synonyms (NCBI Gene) Gene synonyms aliases
MIKI
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein related to the immunoglobulin superfamily that plays a role in mitosis. Knockdown of this gene results in prometaphase arrest, abnormal nuclear morphology and apoptosis. Poly(ADP-ribosylation) of the encoded protein promotes it
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(19)
miRTarBase ID miRNA Experiments Reference
MIRT1044215 hsa-miR-1267 CLIP-seq
MIRT1044216 hsa-miR-3617 CLIP-seq
MIRT1044217 hsa-miR-4289 CLIP-seq
MIRT1044218 hsa-miR-4652-3p CLIP-seq
MIRT1044219 hsa-miR-4684-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 22864114
GO:0005654 Component Nucleoplasm IDA
GO:0005794 Component Golgi apparatus IBA 21873635
GO:0005794 Component Golgi apparatus IDA 22864114
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
614133 27364 ENSG00000188175
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID A8MVW5
Protein name HEPACAM family member 2 (Mitotic kinetics regulator)
Protein function Required during prometaphase for centrosome maturation. Following poly-ADP-ribosylation (PARsylation) by TNKS, translocates from the Golgi apparatus to mitotic centrosomes and plays a key role in the formation of robust microtubules for prompt m
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13927 Ig_3 148 → 223 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:19358830}.
Sequence 
MGQDAFMEPFGDTLGVFQCKIYLLLFGACSGLKVTVPSHTVHGVRGQALYLPVHYGFHTP
ASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNY
IVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAY
QWLKNGRPVHTSSTYSFSPQNNTLHIAPVTKEDIGNYSCLVRNPVSEMESDIIMPIIYYG
PYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRRTDNTTYIIKHGPRLE
VASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLSPLASITGISL
FLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDV
SGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE
Sequence length 462
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Text Mining Associations (7)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 29435733
Colorectal Neoplasms Associate 29659199, 29973580
Idiopathic Noncirrhotic Portal Hypertension Associate 29435733
Leukemia Myelomonocytic Juvenile Associate 19358830
Myelodysplastic Syndromes Inhibit 22864114
Neoplasms Associate 29659199
Neural Tube Defects Associate 19358830