HEPACAM2 (HEPACAM family member 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 253012
Gene name HEPACAM family member 2
Gene symbol HEPACAM2
Synonyms (NCBI Gene)
MIKI
Chromosome 7
Chromosome location 7q21.2
Summary This gene encodes a protein related to the immunoglobulin superfamily that plays a role in mitosis. Knockdown of this gene results in prometaphase arrest, abnormal nuclear morphology and apoptosis. Poly(ADP-ribosylation) of the encoded protein promotes it
miRNA miRNA information provided by mirtarbase database.
19
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (19)
miRTarBase ID miRNA Experiments Reference
MIRT1044215 hsa-miR-1267 CLIP-seq
MIRT1044216 hsa-miR-3617 CLIP-seq
MIRT1044217 hsa-miR-4289 CLIP-seq
MIRT1044218 hsa-miR-4652-3p CLIP-seq
MIRT1044219 hsa-miR-4684-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (22)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 22864114
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005794 Component Golgi apparatus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
614133 27364 ENSG00000188175
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MVW5
Protein name HEPACAM family member 2 (Mitotic kinetics regulator)
Protein function Required during prometaphase for centrosome maturation. Following poly-ADP-ribosylation (PARsylation) by TNKS, translocates from the Golgi apparatus to mitotic centrosomes and plays a key role in the formation of robust microtubules for prompt m
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13927 Ig_3 148 → 223 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:19358830}.
Sequence 
MGQDAFMEPFGDTLGVFQCKIYLLLFGACSGLKVTVPSHTVHGVRGQALYLPVHYGFHTP
ASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNY
IVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAY
QWLKNGRPVHTSSTYSFSPQNNTLHIAPVTKEDIGNYSCLVRNPVSEMESDIIMPIIYYG
PYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRRTDNTTYIIKHGPRLE
VASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLSPLASITGISL
FLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDV
SGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE
Sequence length 462
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193921119 RCV000149386
Show/Hide Text Mining Associations (7)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 29435733
Colorectal Neoplasms Associate 29659199, 29973580
Idiopathic Noncirrhotic Portal Hypertension Associate 29435733
Leukemia Myelomonocytic Juvenile Associate 19358830
Myelodysplastic Syndromes Inhibit 22864114
Neoplasms Associate 29659199
Neural Tube Defects Associate 19358830