Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25
Gene name	ABL proto-oncogene 1, non-receptor tyrosine kinase
Gene symbol	ABL1
Synonyms (NCBI Gene)	ABLBCR-ABLCHDSKMJTK7bcr/ablc-ABLc-ABL1p150v-abl
Chromosome	9
Chromosome location	9q34.12
Summary	This gene is a protooncogene that encodes a protein tyrosine kinase involved in a variety of cellular processes, including cell division, adhesion, differentiation, and response to stress. The activity of the protein is negatively regulated by its SH3 dom

Show/Hide all (25)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121913448	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs121913449	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs121913450	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913451	C>A,G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913452	T>A,C,G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913453	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs121913454	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913455	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913456	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs121913457	T>C	Pathogenic-likely-pathogenic	Coding sequence variant, missense variant
rs121913458	G>C,T	Likely-pathogenic	Coding sequence variant, missense variant
rs121913459	C>T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121913460	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs121913461	T>C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs137853304	T>C	Pathogenic	Coding sequence variant, missense variant
rs387906516	A>T	Pathogenic	Missense variant, coding sequence variant
rs387906517	G>A	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs1057519758	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519771	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519772	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519773	T>A,C,G	Likely-pathogenic, not-provided	Coding sequence variant, missense variant
rs1057519774	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1057519775	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1060499547	A>G	Pathogenic	Coding sequence variant, missense variant
rs1060499548	G>A	Pathogenic	Coding sequence variant, missense variant

555

Show/Hide all (555)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003032	hsa-miR-203a-3p	Luciferase reporter assay	18538733
MIRT003032	hsa-miR-203a-3p	Luciferase reporter assay	18538733
MIRT003032	hsa-miR-203a-3p	Luciferase reporter assay	18538733
MIRT003032	hsa-miR-203a-3p	Review	20029422
MIRT007197	hsa-miR-29a-3p	Luciferase reporter assay	23428668
MIRT007197	hsa-miR-29a-3p	Luciferase reporter assay	23428668
MIRT007359	hsa-miR-30a-5p	Luciferase reporter assayqRT-PCR	23287430
MIRT007359	hsa-miR-30a-5p	Luciferase reporter assayqRT-PCR	23287430
MIRT007359	hsa-miR-30a-5p	Luciferase reporter assayqRT-PCR	23287430
MIRT051948	hsa-let-7b-5p	CLASH	23622248
MIRT046104	hsa-miR-125b-5p	CLASH	23622248
MIRT045402	hsa-miR-149-5p	CLASH	23622248
MIRT045402	hsa-miR-149-5p	CLASH	23622248
MIRT043695	hsa-miR-342-3p	CLASH	23622248
MIRT042250	hsa-miR-484	CLASH	23622248
MIRT053063	hsa-miR-4723-5p	FlowImmunohistochemistryLuciferase reporter assayWestern blot	24223753
MIRT003032	hsa-miR-203a-3p	ImmunoprecipitaionqRT-PCRWestern blot	23462723
MIRT003032	hsa-miR-203a-3p	qRT-PCRWestern blot	23968727
MIRT003032	hsa-miR-203a-3p	qRT-PCRWestern blot	23968727
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT489650	hsa-miR-4779	PAR-CLIP	20371350
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT489647	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT489646	hsa-miR-765	PAR-CLIP	20371350
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT489643	hsa-miR-5698	PAR-CLIP	20371350
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT489650	hsa-miR-4779	PAR-CLIP	23592263
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT489647	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT489646	hsa-miR-765	PAR-CLIP	23592263
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT489643	hsa-miR-5698	PAR-CLIP	23592263
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT227788	hsa-miR-583	PAR-CLIP	23592263
MIRT458704	hsa-miR-548b-3p	PAR-CLIP	23592263
MIRT458703	hsa-miR-4511	PAR-CLIP	23592263
MIRT227790	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT227789	hsa-miR-1537-5p	PAR-CLIP	23592263
MIRT458702	hsa-miR-4718	PAR-CLIP	23592263
MIRT458701	hsa-miR-4999-5p	PAR-CLIP	23592263
MIRT441301	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441301	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	26701625
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT489647	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	26701625
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT489650	hsa-miR-4779	PAR-CLIP	26701625
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	26701625
MIRT489643	hsa-miR-5698	PAR-CLIP	26701625
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	26701625
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT489646	hsa-miR-765	PAR-CLIP	26701625
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT489650	hsa-miR-4779	PAR-CLIP	20371350
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT489647	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT489646	hsa-miR-765	PAR-CLIP	20371350
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT489643	hsa-miR-5698	PAR-CLIP	20371350
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT489653	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT489652	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT489651	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT489650	hsa-miR-4779	PAR-CLIP	23592263
MIRT489648	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT489649	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT489647	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT489646	hsa-miR-765	PAR-CLIP	23592263
MIRT489645	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT489644	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT053063	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT489643	hsa-miR-5698	PAR-CLIP	23592263
MIRT489642	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT489640	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT227788	hsa-miR-583	PAR-CLIP	23592263
MIRT458704	hsa-miR-548b-3p	PAR-CLIP	23592263
MIRT458703	hsa-miR-4511	PAR-CLIP	23592263
MIRT227790	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT227789	hsa-miR-1537-5p	PAR-CLIP	23592263
MIRT458702	hsa-miR-4718	PAR-CLIP	23592263
MIRT458701	hsa-miR-4999-5p	PAR-CLIP	23592263
MIRT760530	hsa-miR-1202	CLIP-seq
MIRT760531	hsa-miR-1207-5p	CLIP-seq
MIRT760532	hsa-miR-1275	CLIP-seq
MIRT760533	hsa-miR-128	CLIP-seq
MIRT760534	hsa-miR-1285	CLIP-seq
MIRT760535	hsa-miR-1286	CLIP-seq
MIRT760536	hsa-miR-140-3p	CLIP-seq
MIRT760537	hsa-miR-141	CLIP-seq
MIRT760538	hsa-miR-1470	CLIP-seq
MIRT760539	hsa-miR-1912	CLIP-seq
MIRT760540	hsa-miR-1914	CLIP-seq
MIRT760541	hsa-miR-200a	CLIP-seq
MIRT760542	hsa-miR-27a	CLIP-seq
MIRT760543	hsa-miR-27b	CLIP-seq
MIRT760544	hsa-miR-296-5p	CLIP-seq
MIRT760545	hsa-miR-3065-3p	CLIP-seq
MIRT760546	hsa-miR-30a	CLIP-seq
MIRT760547	hsa-miR-30b	CLIP-seq
MIRT760548	hsa-miR-30c	CLIP-seq
MIRT760549	hsa-miR-30d	CLIP-seq
MIRT760550	hsa-miR-30e	CLIP-seq
MIRT760551	hsa-miR-3125	CLIP-seq
MIRT760552	hsa-miR-3127-5p	CLIP-seq
MIRT760553	hsa-miR-3157-5p	CLIP-seq
MIRT760554	hsa-miR-3160-5p	CLIP-seq
MIRT760555	hsa-miR-3187-5p	CLIP-seq
MIRT760556	hsa-miR-3202	CLIP-seq
MIRT760557	hsa-miR-326	CLIP-seq
MIRT760558	hsa-miR-330-5p	CLIP-seq
MIRT760559	hsa-miR-3617	CLIP-seq
MIRT760560	hsa-miR-3672	CLIP-seq
MIRT760561	hsa-miR-371-3p	CLIP-seq
MIRT760562	hsa-miR-371b-3p	CLIP-seq
MIRT760563	hsa-miR-378g	CLIP-seq
MIRT760564	hsa-miR-3916	CLIP-seq
MIRT760565	hsa-miR-3918	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT760567	hsa-miR-3972	CLIP-seq
MIRT760568	hsa-miR-4252	CLIP-seq
MIRT760569	hsa-miR-4271	CLIP-seq
MIRT760570	hsa-miR-4291	CLIP-seq
MIRT760571	hsa-miR-4436b-3p	CLIP-seq
MIRT760572	hsa-miR-4447	CLIP-seq
MIRT760573	hsa-miR-4469	CLIP-seq
MIRT760574	hsa-miR-4472	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT760576	hsa-miR-4481	CLIP-seq
MIRT760577	hsa-miR-4486	CLIP-seq
MIRT760578	hsa-miR-4495	CLIP-seq
MIRT760579	hsa-miR-4496	CLIP-seq
MIRT760580	hsa-miR-4525	CLIP-seq
MIRT760581	hsa-miR-4635	CLIP-seq
MIRT760582	hsa-miR-4639-3p	CLIP-seq
MIRT760583	hsa-miR-4665-5p	CLIP-seq
MIRT760584	hsa-miR-4667-3p	CLIP-seq
MIRT760585	hsa-miR-4691-3p	CLIP-seq
MIRT760586	hsa-miR-4706	CLIP-seq
MIRT760587	hsa-miR-4716-3p	CLIP-seq
MIRT760588	hsa-miR-4725-3p	CLIP-seq
MIRT760589	hsa-miR-4728-5p	CLIP-seq
MIRT760590	hsa-miR-4737	CLIP-seq
MIRT760591	hsa-miR-4745-5p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT760593	hsa-miR-4749-5p	CLIP-seq
MIRT760594	hsa-miR-4755-3p	CLIP-seq
MIRT760595	hsa-miR-4763-3p	CLIP-seq
MIRT760596	hsa-miR-4780	CLIP-seq
MIRT760597	hsa-miR-4787-5p	CLIP-seq
MIRT760598	hsa-miR-4797-5p	CLIP-seq
MIRT760599	hsa-miR-485-5p	CLIP-seq
MIRT760600	hsa-miR-486-3p	CLIP-seq
MIRT760601	hsa-miR-488	CLIP-seq
MIRT760602	hsa-miR-494	CLIP-seq
MIRT760603	hsa-miR-501-3p	CLIP-seq
MIRT760604	hsa-miR-502-3p	CLIP-seq
MIRT760605	hsa-miR-513a-5p	CLIP-seq
MIRT760606	hsa-miR-515-3p	CLIP-seq
MIRT760607	hsa-miR-519e	CLIP-seq
MIRT760608	hsa-miR-520a-5p	CLIP-seq
MIRT760609	hsa-miR-525-5p	CLIP-seq
MIRT760610	hsa-miR-526b	CLIP-seq
MIRT760611	hsa-miR-548ad	CLIP-seq
MIRT760612	hsa-miR-564	CLIP-seq
MIRT760613	hsa-miR-576-3p	CLIP-seq
MIRT760614	hsa-miR-578	CLIP-seq
MIRT760615	hsa-miR-604	CLIP-seq
MIRT760616	hsa-miR-612	CLIP-seq
MIRT760617	hsa-miR-623	CLIP-seq
MIRT760618	hsa-miR-625	CLIP-seq
MIRT760619	hsa-miR-641	CLIP-seq
MIRT760620	hsa-miR-939	CLIP-seq
MIRT1924221	hsa-miR-4457	CLIP-seq
MIRT1924222	hsa-miR-4731-3p	CLIP-seq
MIRT760597	hsa-miR-4787-5p	CLIP-seq
MIRT1924223	hsa-miR-4801	CLIP-seq
MIRT1924224	hsa-miR-642b	CLIP-seq
MIRT760530	hsa-miR-1202	CLIP-seq
MIRT1924225	hsa-miR-1224-3p	CLIP-seq
MIRT1924226	hsa-miR-1226	CLIP-seq
MIRT1924227	hsa-miR-1260	CLIP-seq
MIRT1924228	hsa-miR-1260b	CLIP-seq
MIRT760533	hsa-miR-128	CLIP-seq
MIRT1924229	hsa-miR-1280	CLIP-seq
MIRT1924230	hsa-miR-1293	CLIP-seq
MIRT1924231	hsa-miR-136	CLIP-seq
MIRT1924232	hsa-miR-148a	CLIP-seq
MIRT1924233	hsa-miR-148b	CLIP-seq
MIRT1924234	hsa-miR-152	CLIP-seq
MIRT1924235	hsa-miR-2682	CLIP-seq
MIRT760542	hsa-miR-27a	CLIP-seq
MIRT760543	hsa-miR-27b	CLIP-seq
MIRT1924236	hsa-miR-2861	CLIP-seq
MIRT1924237	hsa-miR-3120-5p	CLIP-seq
MIRT760551	hsa-miR-3125	CLIP-seq
MIRT760552	hsa-miR-3127-5p	CLIP-seq
MIRT1924238	hsa-miR-3138	CLIP-seq
MIRT1924239	hsa-miR-3144-5p	CLIP-seq
MIRT760554	hsa-miR-3160-5p	CLIP-seq
MIRT1924240	hsa-miR-3178	CLIP-seq
MIRT1924241	hsa-miR-3179	CLIP-seq
MIRT1924242	hsa-miR-3194-3p	CLIP-seq
MIRT760556	hsa-miR-3202	CLIP-seq
MIRT1924243	hsa-miR-361-5p	CLIP-seq
MIRT1924244	hsa-miR-3649	CLIP-seq
MIRT1924245	hsa-miR-3661	CLIP-seq
MIRT1924246	hsa-miR-3677-5p	CLIP-seq
MIRT1924247	hsa-miR-3688-3p	CLIP-seq
MIRT760561	hsa-miR-371-3p	CLIP-seq
MIRT760562	hsa-miR-371b-3p	CLIP-seq
MIRT760564	hsa-miR-3916	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT1924248	hsa-miR-3936	CLIP-seq
MIRT760567	hsa-miR-3972	CLIP-seq
MIRT1924249	hsa-miR-3978	CLIP-seq
MIRT1924221	hsa-miR-4457	CLIP-seq
MIRT1924250	hsa-miR-4475	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT1924251	hsa-miR-4483	CLIP-seq
MIRT760579	hsa-miR-4496	CLIP-seq
MIRT1924252	hsa-miR-449c	CLIP-seq
MIRT1924253	hsa-miR-4514	CLIP-seq
MIRT1924254	hsa-miR-4520a-3p	CLIP-seq
MIRT760582	hsa-miR-4639-3p	CLIP-seq
MIRT1924255	hsa-miR-4649-5p	CLIP-seq
MIRT1924256	hsa-miR-4651	CLIP-seq
MIRT1924257	hsa-miR-4692	CLIP-seq
MIRT1924258	hsa-miR-4712-5p	CLIP-seq
MIRT1924259	hsa-miR-4713-5p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT760594	hsa-miR-4755-3p	CLIP-seq
MIRT1924260	hsa-miR-4777-3p	CLIP-seq
MIRT760597	hsa-miR-4787-5p	CLIP-seq
MIRT1924261	hsa-miR-490-5p	CLIP-seq
MIRT1924262	hsa-miR-492	CLIP-seq
MIRT1924263	hsa-miR-495	CLIP-seq
MIRT760605	hsa-miR-513a-5p	CLIP-seq
MIRT1924264	hsa-miR-513b	CLIP-seq
MIRT760606	hsa-miR-515-3p	CLIP-seq
MIRT760607	hsa-miR-519e	CLIP-seq
MIRT760608	hsa-miR-520a-5p	CLIP-seq
MIRT760609	hsa-miR-525-5p	CLIP-seq
MIRT1924265	hsa-miR-532-3p	CLIP-seq
MIRT1924266	hsa-miR-541	CLIP-seq
MIRT760611	hsa-miR-548ad	CLIP-seq
MIRT760612	hsa-miR-564	CLIP-seq
MIRT760613	hsa-miR-576-3p	CLIP-seq
MIRT760614	hsa-miR-578	CLIP-seq
MIRT1924267	hsa-miR-608	CLIP-seq
MIRT1924268	hsa-miR-631	CLIP-seq
MIRT1924269	hsa-miR-654-5p	CLIP-seq
MIRT1924270	hsa-miR-770-5p	CLIP-seq
MIRT760530	hsa-miR-1202	CLIP-seq
MIRT2165551	hsa-miR-1205	CLIP-seq
MIRT760531	hsa-miR-1207-5p	CLIP-seq
MIRT2165552	hsa-miR-1234	CLIP-seq
MIRT2165553	hsa-miR-1253	CLIP-seq
MIRT2165554	hsa-miR-1266	CLIP-seq
MIRT760533	hsa-miR-128	CLIP-seq
MIRT760534	hsa-miR-1285	CLIP-seq
MIRT760535	hsa-miR-1286	CLIP-seq
MIRT1924230	hsa-miR-1293	CLIP-seq
MIRT1924231	hsa-miR-136	CLIP-seq
MIRT760536	hsa-miR-140-3p	CLIP-seq
MIRT760537	hsa-miR-141	CLIP-seq
MIRT2165555	hsa-miR-142-5p	CLIP-seq
MIRT1924232	hsa-miR-148a	CLIP-seq
MIRT1924233	hsa-miR-148b	CLIP-seq
MIRT1924234	hsa-miR-152	CLIP-seq
MIRT2165556	hsa-miR-1827	CLIP-seq
MIRT2165557	hsa-miR-1908	CLIP-seq
MIRT760539	hsa-miR-1912	CLIP-seq
MIRT760541	hsa-miR-200a	CLIP-seq
MIRT2165558	hsa-miR-203	CLIP-seq
MIRT2165559	hsa-miR-2114	CLIP-seq
MIRT2165560	hsa-miR-2467-3p	CLIP-seq
MIRT1924235	hsa-miR-2682	CLIP-seq
MIRT760542	hsa-miR-27a	CLIP-seq
MIRT760543	hsa-miR-27b	CLIP-seq
MIRT760545	hsa-miR-3065-3p	CLIP-seq
MIRT1924237	hsa-miR-3120-5p	CLIP-seq
MIRT2165561	hsa-miR-3126-3p	CLIP-seq
MIRT760552	hsa-miR-3127-5p	CLIP-seq
MIRT2165562	hsa-miR-3141	CLIP-seq
MIRT1924239	hsa-miR-3144-5p	CLIP-seq
MIRT760553	hsa-miR-3157-5p	CLIP-seq
MIRT2165563	hsa-miR-3158-3p	CLIP-seq
MIRT760554	hsa-miR-3160-5p	CLIP-seq
MIRT2165564	hsa-miR-3175	CLIP-seq
MIRT1924240	hsa-miR-3178	CLIP-seq
MIRT760555	hsa-miR-3187-5p	CLIP-seq
MIRT1924242	hsa-miR-3194-3p	CLIP-seq
MIRT760556	hsa-miR-3202	CLIP-seq
MIRT2165565	hsa-miR-331-3p	CLIP-seq
MIRT2165566	hsa-miR-3609	CLIP-seq
MIRT1924243	hsa-miR-361-5p	CLIP-seq
MIRT1924244	hsa-miR-3649	CLIP-seq
MIRT1924245	hsa-miR-3661	CLIP-seq
MIRT2165567	hsa-miR-3664-3p	CLIP-seq
MIRT760560	hsa-miR-3672	CLIP-seq
MIRT1924246	hsa-miR-3677-5p	CLIP-seq
MIRT760563	hsa-miR-378g	CLIP-seq
MIRT760565	hsa-miR-3918	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT760567	hsa-miR-3972	CLIP-seq
MIRT760568	hsa-miR-4252	CLIP-seq
MIRT2165568	hsa-miR-4270	CLIP-seq
MIRT2165569	hsa-miR-4287	CLIP-seq
MIRT760570	hsa-miR-4291	CLIP-seq
MIRT2165570	hsa-miR-431	CLIP-seq
MIRT2165571	hsa-miR-4312	CLIP-seq
MIRT2165572	hsa-miR-4426	CLIP-seq
MIRT2165573	hsa-miR-4434	CLIP-seq
MIRT760571	hsa-miR-4436b-3p	CLIP-seq
MIRT2165574	hsa-miR-4437	CLIP-seq
MIRT2165575	hsa-miR-4441	CLIP-seq
MIRT1924250	hsa-miR-4475	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT1924251	hsa-miR-4483	CLIP-seq
MIRT760577	hsa-miR-4486	CLIP-seq
MIRT2165576	hsa-miR-4493	CLIP-seq
MIRT1924252	hsa-miR-449c	CLIP-seq
MIRT2165577	hsa-miR-4512	CLIP-seq
MIRT1924253	hsa-miR-4514	CLIP-seq
MIRT2165578	hsa-miR-4516	CLIP-seq
MIRT2165579	hsa-miR-4518	CLIP-seq
MIRT2165580	hsa-miR-4646-3p	CLIP-seq
MIRT2165581	hsa-miR-4647	CLIP-seq
MIRT1924255	hsa-miR-4649-5p	CLIP-seq
MIRT2165582	hsa-miR-4662b	CLIP-seq
MIRT2165583	hsa-miR-4672	CLIP-seq
MIRT2165584	hsa-miR-4674	CLIP-seq
MIRT2165585	hsa-miR-4685-3p	CLIP-seq
MIRT760585	hsa-miR-4691-3p	CLIP-seq
MIRT1924257	hsa-miR-4692	CLIP-seq
MIRT2165586	hsa-miR-4708-3p	CLIP-seq
MIRT1924258	hsa-miR-4712-5p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT2165587	hsa-miR-4753-5p	CLIP-seq
MIRT760594	hsa-miR-4755-3p	CLIP-seq
MIRT2165588	hsa-miR-4761-5p	CLIP-seq
MIRT760595	hsa-miR-4763-3p	CLIP-seq
MIRT2165589	hsa-miR-4768-5p	CLIP-seq
MIRT1924260	hsa-miR-4777-3p	CLIP-seq
MIRT760596	hsa-miR-4780	CLIP-seq
MIRT760597	hsa-miR-4787-5p	CLIP-seq
MIRT760598	hsa-miR-4797-5p	CLIP-seq
MIRT2165590	hsa-miR-4798-3p	CLIP-seq
MIRT760599	hsa-miR-485-5p	CLIP-seq
MIRT760600	hsa-miR-486-3p	CLIP-seq
MIRT1924261	hsa-miR-490-5p	CLIP-seq
MIRT1924262	hsa-miR-492	CLIP-seq
MIRT760602	hsa-miR-494	CLIP-seq
MIRT1924263	hsa-miR-495	CLIP-seq
MIRT2165591	hsa-miR-499-3p	CLIP-seq
MIRT2165592	hsa-miR-499a-3p	CLIP-seq
MIRT760603	hsa-miR-501-3p	CLIP-seq
MIRT760604	hsa-miR-502-3p	CLIP-seq
MIRT760605	hsa-miR-513a-5p	CLIP-seq
MIRT1924266	hsa-miR-541	CLIP-seq
MIRT2165593	hsa-miR-542-5p	CLIP-seq
MIRT2165594	hsa-miR-548a-5p	CLIP-seq
MIRT2165595	hsa-miR-548ab	CLIP-seq
MIRT2165596	hsa-miR-548ah	CLIP-seq
MIRT2165597	hsa-miR-548ak	CLIP-seq
MIRT2165598	hsa-miR-548b-5p	CLIP-seq
MIRT2165599	hsa-miR-548c-5p	CLIP-seq
MIRT2165600	hsa-miR-548d-5p	CLIP-seq
MIRT2165601	hsa-miR-548h	CLIP-seq
MIRT2165602	hsa-miR-548i	CLIP-seq
MIRT2165603	hsa-miR-548j	CLIP-seq
MIRT2165604	hsa-miR-548k	CLIP-seq
MIRT2165605	hsa-miR-548l	CLIP-seq
MIRT2165606	hsa-miR-548t	CLIP-seq
MIRT2165607	hsa-miR-548w	CLIP-seq
MIRT2165608	hsa-miR-548y	CLIP-seq
MIRT2165609	hsa-miR-554	CLIP-seq
MIRT2165610	hsa-miR-559	CLIP-seq
MIRT760613	hsa-miR-576-3p	CLIP-seq
MIRT760614	hsa-miR-578	CLIP-seq
MIRT760616	hsa-miR-612	CLIP-seq
MIRT760617	hsa-miR-623	CLIP-seq
MIRT2165611	hsa-miR-626	CLIP-seq
MIRT1924268	hsa-miR-631	CLIP-seq
MIRT1924269	hsa-miR-654-5p	CLIP-seq
MIRT2165612	hsa-miR-661	CLIP-seq
MIRT2165613	hsa-miR-663	CLIP-seq
MIRT2165614	hsa-miR-668	CLIP-seq
MIRT2165615	hsa-miR-744	CLIP-seq
MIRT1924270	hsa-miR-770-5p	CLIP-seq
MIRT2165616	hsa-miR-873	CLIP-seq
MIRT2165617	hsa-miR-940	CLIP-seq
MIRT760599	hsa-miR-485-5p	CLIP-seq
MIRT2425895	hsa-miR-3654	CLIP-seq
MIRT2425896	hsa-miR-4698	CLIP-seq
MIRT2425897	hsa-miR-4740-3p	CLIP-seq
MIRT2425898	hsa-miR-711	CLIP-seq
MIRT2442962	hsa-miR-1343	CLIP-seq
MIRT2442963	hsa-miR-18a	CLIP-seq
MIRT2442964	hsa-miR-18b	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT2165568	hsa-miR-4270	CLIP-seq
MIRT2165575	hsa-miR-4441	CLIP-seq
MIRT2442965	hsa-miR-4640-5p	CLIP-seq
MIRT2165586	hsa-miR-4708-3p	CLIP-seq
MIRT2442966	hsa-miR-4726-5p	CLIP-seq
MIRT2442967	hsa-miR-4735-3p	CLIP-seq
MIRT2165587	hsa-miR-4753-5p	CLIP-seq
MIRT2165588	hsa-miR-4761-5p	CLIP-seq
MIRT2165554	hsa-miR-1266	CLIP-seq
MIRT2467709	hsa-miR-1270	CLIP-seq
MIRT2442963	hsa-miR-18a	CLIP-seq
MIRT2442964	hsa-miR-18b	CLIP-seq
MIRT2467710	hsa-miR-196a	CLIP-seq
MIRT2467711	hsa-miR-196b	CLIP-seq
MIRT2467712	hsa-miR-19a	CLIP-seq
MIRT2467713	hsa-miR-19b	CLIP-seq
MIRT2467714	hsa-miR-2115	CLIP-seq
MIRT2467715	hsa-miR-3155	CLIP-seq
MIRT2467716	hsa-miR-3155b	CLIP-seq
MIRT1924241	hsa-miR-3179	CLIP-seq
MIRT2467717	hsa-miR-3180	CLIP-seq
MIRT2467718	hsa-miR-3180-3p	CLIP-seq
MIRT2467719	hsa-miR-3184	CLIP-seq
MIRT2467720	hsa-miR-3185	CLIP-seq
MIRT2467721	hsa-miR-3190	CLIP-seq
MIRT2467722	hsa-miR-3196	CLIP-seq
MIRT2467723	hsa-miR-3616-3p	CLIP-seq
MIRT2467724	hsa-miR-378	CLIP-seq
MIRT2467725	hsa-miR-378b	CLIP-seq
MIRT2467726	hsa-miR-378c	CLIP-seq
MIRT2467727	hsa-miR-378d	CLIP-seq
MIRT2467728	hsa-miR-378e	CLIP-seq
MIRT2467729	hsa-miR-378f	CLIP-seq
MIRT2467730	hsa-miR-378h	CLIP-seq
MIRT2467731	hsa-miR-378i	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT2467732	hsa-miR-3927	CLIP-seq
MIRT1924248	hsa-miR-3936	CLIP-seq
MIRT2467733	hsa-miR-3937	CLIP-seq
MIRT2467734	hsa-miR-411	CLIP-seq
MIRT2467735	hsa-miR-422a	CLIP-seq
MIRT2467736	hsa-miR-4277	CLIP-seq
MIRT2467737	hsa-miR-4283	CLIP-seq
MIRT2467738	hsa-miR-432	CLIP-seq
MIRT2165573	hsa-miR-4434	CLIP-seq
MIRT760571	hsa-miR-4436b-3p	CLIP-seq
MIRT1924221	hsa-miR-4457	CLIP-seq
MIRT2467739	hsa-miR-4466	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT2467740	hsa-miR-4487	CLIP-seq
MIRT2165578	hsa-miR-4516	CLIP-seq
MIRT2165579	hsa-miR-4518	CLIP-seq
MIRT2467741	hsa-miR-4531	CLIP-seq
MIRT1924256	hsa-miR-4651	CLIP-seq
MIRT760586	hsa-miR-4706	CLIP-seq
MIRT1924259	hsa-miR-4713-5p	CLIP-seq
MIRT760589	hsa-miR-4728-5p	CLIP-seq
MIRT1924222	hsa-miR-4731-3p	CLIP-seq
MIRT2467742	hsa-miR-4732-5p	CLIP-seq
MIRT2442967	hsa-miR-4735-3p	CLIP-seq
MIRT2467743	hsa-miR-4746-3p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT760593	hsa-miR-4749-5p	CLIP-seq
MIRT2467744	hsa-miR-4786-3p	CLIP-seq
MIRT2467745	hsa-miR-4795-5p	CLIP-seq
MIRT1924223	hsa-miR-4801	CLIP-seq
MIRT760608	hsa-miR-520a-5p	CLIP-seq
MIRT760609	hsa-miR-525-5p	CLIP-seq
MIRT760612	hsa-miR-564	CLIP-seq
MIRT1924267	hsa-miR-608	CLIP-seq
MIRT2467746	hsa-miR-620	CLIP-seq
MIRT1924224	hsa-miR-642b	CLIP-seq
MIRT2467747	hsa-miR-675	CLIP-seq
MIRT2467748	hsa-miR-7	CLIP-seq
MIRT2165554	hsa-miR-1266	CLIP-seq
MIRT2467709	hsa-miR-1270	CLIP-seq
MIRT2442963	hsa-miR-18a	CLIP-seq
MIRT2442964	hsa-miR-18b	CLIP-seq
MIRT2467712	hsa-miR-19a	CLIP-seq
MIRT2467713	hsa-miR-19b	CLIP-seq
MIRT2467714	hsa-miR-2115	CLIP-seq
MIRT2467715	hsa-miR-3155	CLIP-seq
MIRT2467716	hsa-miR-3155b	CLIP-seq
MIRT1924241	hsa-miR-3179	CLIP-seq
MIRT2467717	hsa-miR-3180	CLIP-seq
MIRT2467718	hsa-miR-3180-3p	CLIP-seq
MIRT2467719	hsa-miR-3184	CLIP-seq
MIRT2467720	hsa-miR-3185	CLIP-seq
MIRT2467721	hsa-miR-3190	CLIP-seq
MIRT2467722	hsa-miR-3196	CLIP-seq
MIRT2674124	hsa-miR-3615	CLIP-seq
MIRT2467723	hsa-miR-3616-3p	CLIP-seq
MIRT2674125	hsa-miR-3646	CLIP-seq
MIRT2674126	hsa-miR-3662	CLIP-seq
MIRT2674127	hsa-miR-3917	CLIP-seq
MIRT760566	hsa-miR-3922-5p	CLIP-seq
MIRT1924248	hsa-miR-3936	CLIP-seq
MIRT2467733	hsa-miR-3937	CLIP-seq
MIRT2467736	hsa-miR-4277	CLIP-seq
MIRT2467737	hsa-miR-4283	CLIP-seq
MIRT2467738	hsa-miR-432	CLIP-seq
MIRT2165573	hsa-miR-4434	CLIP-seq
MIRT760571	hsa-miR-4436b-3p	CLIP-seq
MIRT1924221	hsa-miR-4457	CLIP-seq
MIRT2467739	hsa-miR-4466	CLIP-seq
MIRT760575	hsa-miR-4476	CLIP-seq
MIRT2165578	hsa-miR-4516	CLIP-seq
MIRT2165579	hsa-miR-4518	CLIP-seq
MIRT2467741	hsa-miR-4531	CLIP-seq
MIRT1924256	hsa-miR-4651	CLIP-seq
MIRT2674128	hsa-miR-4653-3p	CLIP-seq
MIRT760586	hsa-miR-4706	CLIP-seq
MIRT1924259	hsa-miR-4713-5p	CLIP-seq
MIRT760589	hsa-miR-4728-5p	CLIP-seq
MIRT1924222	hsa-miR-4731-3p	CLIP-seq
MIRT2442967	hsa-miR-4735-3p	CLIP-seq
MIRT2467743	hsa-miR-4746-3p	CLIP-seq
MIRT760592	hsa-miR-4747-5p	CLIP-seq
MIRT760593	hsa-miR-4749-5p	CLIP-seq
MIRT2467744	hsa-miR-4786-3p	CLIP-seq
MIRT2467745	hsa-miR-4795-5p	CLIP-seq
MIRT1924223	hsa-miR-4801	CLIP-seq
MIRT760608	hsa-miR-520a-5p	CLIP-seq
MIRT760609	hsa-miR-525-5p	CLIP-seq
MIRT760612	hsa-miR-564	CLIP-seq
MIRT1924267	hsa-miR-608	CLIP-seq
MIRT2467746	hsa-miR-620	CLIP-seq
MIRT1924224	hsa-miR-642b	CLIP-seq
MIRT2467747	hsa-miR-675	CLIP-seq
MIRT2467748	hsa-miR-7	CLIP-seq

247

Show/Hide all (247)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	TAS	24522549
GO:0000287	Function	Magnesium ion binding	IDA	9144171
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000400	Function	Four-way junction DNA binding	IDA	9558345
GO:0000405	Function	Bubble DNA binding	IDA	9558345
GO:0001726	Component	Ruffle	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0001843	Process	Neural tube closure	IEA
GO:0001922	Process	B-1 B cell homeostasis	IEA
GO:0002252	Process	Immune effector process	IEA
GO:0002322	Process	B cell proliferation involved in immune response	IEA
GO:0002333	Process	Transitional one stage B cell differentiation	IEA
GO:0002429	Process	Immune response-activating cell surface receptor signaling pathway	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	8242749
GO:0003713	Function	Transcription coactivator activity	TAS	15865930
GO:0003785	Function	Actin monomer binding	IEA
GO:0003785	Function	Actin monomer binding	TAS	20841568
GO:0004515	Function	Nicotinate-nucleotide adenylyltransferase activity	TAS	20841568
GO:0004672	Function	Protein kinase activity	IDA	11120811
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	24863063
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	24700464
GO:0004713	Function	Protein tyrosine kinase activity	EXP	15657136
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	7590236, 9144171, 10713049, 11121037, 12944467, 15657060, 17888034, 20823226
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	22810897, 24520051
GO:0004713	Function	Protein tyrosine kinase activity	TAS	10391249
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	9461559, 10518561
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IMP	28428613
GO:0005080	Function	Protein kinase C binding	IPI	10713049
GO:0005515	Function	Protein binding	IPI	9144171, 9168117, 9346925, 9461559, 9593709, 11374898, 11375976, 11418237, 11971963, 12384576, 15448168, 15657060, 15696159, 15886098, 16273093, 16397227, 16443220, 16831423, 16888623, 17101133, 17112510, 17318191, 17474147, 17515907, 17626041, 17888034, 18328268, 19234221, 19442657
GO:0005524	Function	ATP binding	IDA	9144171
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	9168116, 17626041, 17888034
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	NAS	8242749
GO:0005634	Component	Nucleus	TAS	20841568
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	12944467, 17626041
GO:0005737	Component	Cytoplasm	IDA	17515907
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	20841568
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	NAS	24522549
GO:0005829	Component	Cytosol	IDA	11120811
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006298	Process	Mismatch repair	TAS	10391249
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	8242749
GO:0006897	Process	Endocytosis	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IDA	15657060
GO:0006974	Process	DNA damage response	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IGI	17626041
GO:0007155	Process	Cell adhesion	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IMP	24367707
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	24863063
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008047	Function	Enzyme activator activity	IDA	12893824
GO:0008306	Process	Associative learning	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	TAS	10391249, 20841568
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	TAS	20841568
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IBA
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	24863063
GO:0014069	Component	Postsynaptic density	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	20841568
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016301	Function	Kinase activity	IMP	28288113
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	12893824
GO:0019901	Function	Protein kinase binding	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0019905	Function	Syntaxin binding	IPI	23006999
GO:0021587	Process	Cerebellum morphogenesis	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IEA
GO:0030035	Process	Microspike assembly	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030100	Process	Regulation of endocytosis	TAS	20841568
GO:0030145	Function	Manganese ion binding	IDA	9144171
GO:0030145	Function	Manganese ion binding	IEA
GO:0030155	Process	Regulation of cell adhesion	TAS	20841568
GO:0030182	Process	Neuron differentiation	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030516	Process	Regulation of axon extension	IMP	24520051
GO:0030845	Process	Phospholipase C-inhibiting G protein-coupled receptor signaling pathway	IMP	24367707
GO:0031113	Process	Regulation of microtubule polymerization	IMP	24520051
GO:0031252	Component	Cell leading edge	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IMP	26051942
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	24520051, 24863063
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	20841568
GO:0032991	Component	Protein-containing complex	IPI	12384576
GO:0033554	Process	Cellular response to stress	IEA
GO:0033690	Process	Positive regulation of osteoblast proliferation	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0034599	Process	Cellular response to oxidative stress	IDA	12893824
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	TAS	24522549
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0035556	Process	Intracellular signal transduction	IDA	9144171, 11121037
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035791	Process	Platelet-derived growth factor receptor-beta signaling pathway	IMP	24520051
GO:0036211	Process	Protein modification process	NAS	8242749
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0038189	Process	Neuropilin signaling pathway	IMP	24863063
GO:0038191	Function	Neuropilin binding	IEA
GO:0038191	Function	Neuropilin binding	IPI	24863063
GO:0042100	Process	B cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042169	Function	SH2 domain binding	IPI	12384576
GO:0042770	Process	Signal transduction in response to DNA damage	IDA	9037071, 15657060, 18280240
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9037071
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	10713049
GO:0043542	Process	Endothelial cell migration	IMP	24863063
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0045580	Process	Regulation of T cell differentiation	ISS
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	15865930
GO:0046632	Process	Alpha-beta T cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0046875	Function	Ephrin receptor binding	ISS
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17888034
GO:0048536	Process	Spleen development	IEA
GO:0048538	Process	Thymus development	IEA
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0051015	Function	Actin filament binding	IEA
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	11121037
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051444	Process	Negative regulation of ubiquitin-protein transferase activity	IDA	20823226
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	24863063
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	24522549
GO:0051882	Process	Mitochondrial depolarization	TAS	24522549
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	24863063
GO:0060020	Process	Bergmann glial cell differentiation	IEA
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060563	Process	Neuroepithelial cell differentiation	IEA
GO:0070064	Function	Proline-rich region binding	IDA	15657060
GO:0070097	Function	Delta-catenin binding	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	10713049
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071103	Process	DNA conformation change	IDA	9558345
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071871	Process	Response to epinephrine	IEA
GO:0072359	Process	Circulatory system development	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0097100	Function	Supercoiled DNA binding	IDA	9558345
GO:0097706	Process	Vascular endothelial cell response to oscillatory fluid shear stress	TAS
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098794	Component	Postsynapse	TAS	24658113
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099150	Process	Regulation of postsynaptic specialization assembly	IEA
GO:0141214	Process	Positive regulation of phospholipase C/protein kinase C signal transduction	IDA	10713049
GO:1900006	Process	Positive regulation of dendrite development	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	24863063
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IEA
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	ISS
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1903053	Process	Regulation of extracellular matrix organization	IEA
GO:1903055	Process	Positive regulation of extracellular matrix organization	IEA
GO:1903210	Process	Podocyte apoptotic process	IEA
GO:1903351	Process	Cellular response to dopamine	TAS	24522549
GO:1903905	Process	Positive regulation of establishment of T cell polarity	IEA
GO:1903905	Process	Positive regulation of establishment of T cell polarity	ISS
GO:1904157	Process	DN4 thymocyte differentiation	IEA
GO:1904518	Process	Protein localization to cytoplasmic microtubule plus-end	IMP	24520051
GO:1905244	Process	Regulation of modification of synaptic structure	IEA
GO:1905244	Process	Regulation of modification of synaptic structure	ISS
GO:1905555	Process	Positive regulation of blood vessel branching	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	9558345
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IDA	9461559
GO:2000096	Process	Positive regulation of Wnt signaling pathway, planar cell polarity pathway	IEA
GO:2000145	Process	Regulation of cell motility	TAS	20841568
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IEA
GO:2000406	Process	Positive regulation of T cell migration	IEA
GO:2000406	Process	Positive regulation of T cell migration	ISS
GO:2000772	Process	Regulation of cellular senescence	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IEA

MIM	HGNC	e!Ensembl
189980	76	ENSG00000097007

P00519

Protein name

Tyrosine-protein kinase ABL1 (EC 2.7.10.2) (Abelson murine leukemia viral oncogene homolog 1) (Abelson tyrosine-protein kinase 1) (Proto-oncogene c-Abl) (p150)

Protein function

Non-receptor tyrosine-protein kinase that plays a role in many key processes linked to cell growth and survival such as cytoskeleton remodeling in response to extracellular stimuli, cell motility and adhesion, receptor endocytosis, autophagy, DN

PDB

1AB2 , 1AWO , 1BBZ , 1JU5 , 1OPL , 1ZZP , 2ABL , 2E2B , 2F4J , 2FO0 , 2G1T , 2G2F , 2G2H , 2G2I , 2GQG , 2HIW , 2HYY , 2HZ0 , 2HZ4 , 2HZI , 2O88 , 2V7A , 3CS9 , 3EG0 , 3EG1 , 3EG2 , 3EG3 , 3EGU , 3K2M , 3PYY , 3QRI , 3QRJ , 3QRK , 3T04 , 3UE4 , 3UYO , 4J9B , 4J9C , 4J9D , 4J9E , 4J9F , 4J9G , 4J9H , 4J9I , 4JJB , 4JJC , 4JJD , 4TWP , 4WA9 , 4XEY , 4YC8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	67 → 113	SH3 domain	Domain
PF00017	SH2	127 → 202	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	242 → 493	Protein tyrosine and serine/threonine kinase	Domain
PF08919	F_actin_bind	1025 → 1130	F-actin binding	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE
HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF
SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP
KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV
TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP
PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE
RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR

Sequence length

1130

Interactions

View interactions

	KEGG		Reactome
	ErbB signaling pathway Ras signaling pathway Cell cycle Axon guidance Neurotrophin signaling pathway Pathogenic Escherichia coli infection Pathways in cancer MicroRNAs in cancer Chemical carcinogenesis - reactive oxygen species Chronic myeloid leukemia Viral myocarditis		Regulation of actin dynamics for phagocytic cup formation Role of ABL in ROBO-SLIT signaling Myogenesis RHO GTPases Activate WASPs and WAVEs HDR through Single Strand Annealing (SSA) Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Cyclin D associated events in G1 RUNX1 regulates transcription of genes involved in differentiation of HSCs FCGR3A-mediated phagocytosis

109

Show/Hide Causal Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
ABL1-related disorder	Likely pathogenic; Pathogenic	rs1831099962	RCV001249439
Abnormal skeletal morphology	Pathogenic; Likely pathogenic	rs1060499548, rs1060499547	RCV000445566 RCV000445576
Chronic myelogenous leukemia, BCR-ABL1 positive	Likely pathogenic; Pathogenic	rs121913459, rs137853304, rs121913457	RCV000432136 RCV000013463 RCV000420800
Congenital heart defects and skeletal malformations syndrome	Likely pathogenic; Pathogenic	rs1355021408, rs2133017541, rs2132956266, rs2133022634, rs2490715483, rs2490721921, rs1060499548, rs1060499547, rs1831097846, rs1831432715, rs1831388695, rs1831432776, rs1831433011, rs1830947813	RCV001330378 RCV001543418 RCV002273061 RCV002466765 RCV003148148 RCV003986042 RCV000496371 RCV000496944 RCV001175161 RCV001265618 RCV001263086 RCV001263087 RCV001263088 RCV001269278
Congenital heart disease	Pathogenic; Likely pathogenic	rs1060499548, rs1060499547	RCV000445566 RCV000445576
Failure to thrive	Pathogenic; Likely pathogenic	rs1060499548, rs1060499547	RCV000445566 RCV000445576
Leukemia, Philadelphia chromosome-positive, resistant to imatinib	Likely pathogenic; Pathogenic	rs121913459, rs387906516, rs387906517, rs121913461	RCV000013459 RCV000013460 RCV000013461 RCV000013462
Lip and oral cavity carcinoma	Pathogenic	rs121913449, rs121913454	RCV001255639 RCV001255640
Microcephaly	Likely pathogenic; Pathogenic	rs1831432776	RCV001527376
Moyamoya angiopathy	Likely pathogenic	rs1830947762	RCV004704502

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
ABL1-related congenital heart defects and skeletal malformations syndrome	Uncertain significance	rs2490715497	RCV002467387
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive	-	rs1057519771	RCV005430093
Developmental disorder	Uncertain significance	rs2490749712	RCV003764448
Hepatocellular carcinoma	Benign	rs34011272	RCV005921014
Neurodevelopmental abnormality	Likely benign	rs1831276610	RCV001264647

Show/Hide Text Mining Associations (205)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Stimulate	19563513
Acute Disease	Associate	8642285
Adenocarcinoma of Lung	Associate	23922113
Agnosia	Associate	1742479, 18615627, 2157692, 21804629, 9116308
Agranulocytosis	Associate	36912524
Alzheimer Disease	Associate	19363261, 25219501, 31755389, 36552734
Amyotrophic Lateral Sclerosis	Associate	28539470, 32005289, 36552734
Anemia	Associate	21804629, 32954738
Anemia Hemolytic	Associate	35731275
Anemia Hemolytic Autoimmune	Associate	32118733
Anemia Sickle Cell	Associate	34625105
Aphasia Conduction	Associate	30855488
Astrocytoma	Associate	15367334
Ataxia Telangiectasia	Associate	17609427
Axenfeld Rieger syndrome	Associate	30855488
Bjornstad syndrome	Stimulate	34979982
Blast Crisis	Associate	12823349, 15050919, 16304379, 18202228, 19048492, 19563513, 20010464, 20015884, 22653972, 29022901, 29967129, 30583336, 32052899, 32366154, 35456386, 35815090, 38188610 View all (2 more)
Blast Injuries	Associate	11287973, 18809762, 25916436, 26087013, 2885048, 38426696
Breast Neoplasms	Associate	18042273, 20234815, 22238610, 22608253, 22865780, 23892407, 24789045, 28661474, 30488343, 32734521
Breast Neoplasms	Stimulate	23383209
Bronchiolitis Obliterans Syndrome	Inhibit	12492591
Burkitt Lymphoma	Associate	37503586, 8408711
Capillary Malformation Arteriovenous Malformation	Associate	33223528
Carcinogenesis	Stimulate	29022901
Carcinoma Hepatocellular	Associate	19897486, 30775435, 37224078
Carcinoma Neuroendocrine	Associate	34635145
Carcinoma Non Small Cell Lung	Associate	16410245
Carcinoma Pancreatic Ductal	Associate	37533202
Carcinoma Renal Cell	Associate	29056573, 30297534
Carcinoma Small Cell	Associate	38068992
Carcinoma Squamous Cell	Associate	36869079
Cardiotoxicity	Associate	35944901
Cell Transformation Neoplastic	Associate	27732969
Cell Transformation Viral	Associate	22183070
Central Nervous System Diseases	Associate	28451802
Central Nervous System Infections	Associate	28451802
Chondrosarcoma	Associate	10748867
Chromosome 7 monosomy	Associate	10520010
Chromosome Aberrations	Stimulate	19346652, 21203397
Chromosome Aberrations	Associate	23320983, 32404952, 36448578, 38037221
Chromosome Disorders	Associate	29521048
Chronic Disease	Associate	21318952
Cleft Palate	Associate	30714299, 31350815
Cobblestone Lissencephaly	Associate	26016997
Colorectal Neoplasms	Associate	12681507, 17196995, 20233444, 31782259
Complement Component C1s Deficiency	Associate	31537905
Corneal Endothelial Cell Loss	Associate	37983208
Coxa Magna	Associate	35035862, 35118903
Cytochrome c Oxidase Deficiency	Associate	22174159
Death	Associate	12365015, 18835836, 25692130
Dementia Multi Infarct	Associate	18831787
Desmoid disease hereditary	Associate	37943631
Developmental Defects of Enamel	Associate	30855488
Diabetes Gestational	Associate	33890634
DiGeorge Syndrome	Associate	36766762
Disease	Associate	30855488, 37503586
Down Syndrome	Associate	18202228, 25049327
Drug Related Side Effects and Adverse Reactions	Associate	14564482, 19363261, 22462553, 25148385, 27821800, 37102603, 8562937
Emanuel syndrome	Stimulate	18156492, 18728022, 23642027, 37510256, 6091099
Emanuel syndrome	Associate	2171702, 24060591, 33433047
Endometrial Neoplasms	Associate	30827726
Endometriosis	Associate	35587747
Eosinophilia	Associate	20955401, 37454239
Epileptic Encephalopathy Early Infantile 3	Associate	33223528
Esophageal Neoplasms	Associate	23117882
Exanthema	Associate	28224300
Fanconi Anemia	Associate	21203397
Fatigue	Associate	28224300, 30419862, 32954738
Fever	Associate	36524116
Fibrosis	Associate	19180499, 22728287
Gallbladder Neoplasms	Associate	37108401
Gastritis	Associate	30704478
Gastrointestinal Stromal Tumors	Associate	27965460
GATA2 Deficiency	Associate	11877286
Genetic Diseases Inborn	Associate	32378810
Genetic Predisposition to Disease	Associate	32378810
Glioblastoma	Associate	19275932, 23383209, 27293031, 27732969, 34875133
Graft vs Host Disease	Associate	12829610
Head and Neck Neoplasms	Associate	34635145
Headache	Associate	28224300
Hearing Loss	Associate	33223528
Heart Defects Congenital	Associate	33223528
Heart defects limb shortening	Associate	33223528
Hematologic Diseases	Associate	18223278
Hematologic Neoplasms	Associate	12842979, 12893773, 15389905, 16291747, 18079735, 19010823, 19135771, 20417861, 2224129, 22349810, 23637631, 24813251, 25887498, 3456250, 37895201
Hepatitis B	Associate	20018760, 23107779, 30775435, 32859541, 33890726
Hereditary leiomyomatosis and renal cell cancer	Associate	30297534
Hodgkin Disease	Associate	21385932
Holoprosencephaly recurrent infections and monocytosis	Associate	10583263
Hypereosinophilic Syndrome	Associate	16906325
Hypersensitivity Delayed	Associate	10688838
Hypertelorism with esophageal abnormality and hypospadias	Associate	18480061
Hypotension	Associate	22691121, 36485103
Hypoxia	Stimulate	21071498, 27055152
Hypoxia	Inhibit	21347297
Hypoxia Brain	Associate	27055152
Infections	Associate	20585556, 34205064
Inflammation	Associate	34638557, 35815090, 36094045
Leukemia	Associate	10210325, 10477734, 10536003, 10682862, 10688835, 10727459, 10979973, 11157490, 11313280, 11877286, 11964283, 12086872, 12594572, 12642693, 12730115 View all (159 more)
Leukemia	Stimulate	12750174, 21084860
Leukemia B Cell	Associate	18815194, 18932238, 34625105, 37196217
Leukemia Biphenotypic Acute	Associate	10936868, 19138562, 21391972, 21623761, 24729118, 26887044, 29531323, 32150610, 32378810, 33361731, 33419251, 33781217, 33808300, 33890726, 35484682, 36219502, 36965095, 37116143 View all (3 more)
Leukemia Erythroblastic Acute	Associate	1997745
Leukemia Lymphocytic Chronic B Cell	Associate	10583264, 10886215, 10931001, 11126203, 11167748, 11442504, 11529849, 11736939, 11986783, 12028026, 12060123, 12181044, 12202756, 12358910, 12716364 View all (65 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	26290562, 35358275
Leukemia Lymphoid	Associate	18809762
Leukemia Megakaryoblastic Acute	Associate	12060665, 22075327, 34053988
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10068681, 10339507, 10390193, 10398316, 10468608, 10480429, 10480430, 10498589, 10498618, 10509158, 10520010, 10536003, 10561500, 10583263, 10602778 View all (793 more)
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	12506035, 21500096, 22775238, 25485495, 30197352, 31373443, 32118733
Leukemia Myeloid	Associate	10648417, 11313280, 18519632, 18809762, 25446257, 29967475, 30049824, 9949177
Leukemia Myeloid	Stimulate	28982308
Leukemia Myeloid Acute	Associate	10480430, 10979973, 12060665, 12446442, 12920036, 15388581, 15607956, 16304046, 18073350, 21275954, 21536647, 2370860, 23806810, 26017033, 26221900 View all (28 more)
Leukemia Myeloid Chronic Atypical BCR ABL Negative	Associate	17764812, 9326244
Leukemia Myeloid Chronic Phase	Stimulate	20606363
Leukemia Myeloid Chronic Phase	Associate	23409026, 2684296, 28550414, 31350815, 31638195, 34407543
Leukemia Myelomonocytic Acute	Associate	10590083
Leukemia Myelomonocytic Juvenile	Associate	10583263, 27061824
Leukemia Neutrophilic Chronic	Associate	9038742, 9886327
Leukemia Prolymphocytic T Cell	Associate	31974418
Leukemia T Cell	Associate	10468851, 11380477, 12719399, 14687026, 16156854, 24365090, 8408711, 9266939, 9695962, 9886327
Leukocytosis	Associate	28437552
Livedoid Vasculopathy	Associate	19180499
Lymphoma	Associate	24060591, 37454239
Lymphoma B Cell Marginal Zone	Associate	27382024
Lymphoma Follicular	Associate	25894969
Lymphoma T Cell	Associate	27821800
Lymphopenia	Associate	12220663
Malformations of Cortical Development Group I	Associate	18490454, 31413564
Medulloblastoma	Associate	35967388
Melanoma	Stimulate	23383209
Melanoma	Associate	37963252
Mental Retardation Autosomal Dominant 1	Associate	33223528
Mesothelioma Malignant	Associate	33107354
Microcephaly	Associate	33223528
Mitochondrial Diseases	Associate	9473236
Mucocutaneous Lymph Node Syndrome	Associate	35762721
Multiple Myeloma	Associate	14632777, 20730794, 26434776, 28087699, 36555805, 37992230
Multiple Sclerosis	Associate	23469041
Myelocytic leukemia like syndrome familial chronic	Associate	8562932
Myelodysplastic Myeloproliferative Diseases	Associate	22511494
Myelodysplastic Syndromes	Associate	12898186, 36307214, 9266939
Myeloproliferative Disorders	Associate	16225651, 16304380, 17249502, 17644735, 18757400, 19109573, 21318952, 22511494, 23599815, 26291129, 29500381, 33541399, 3866076, 7565761, 9038742
Myopathies Structural Congenital	Associate	19888473
Nausea	Associate	28224300
Necrosis	Associate	14645012
Neoplasm Invasiveness	Associate	24789045
Neoplasm Metastasis	Associate	20234815, 30827726, 37169211
Neoplasm Residual	Associate	10468851, 24072036, 27235138, 33361712
Neoplasms	Associate	10688838, 12716888, 14530811, 14726674, 16906325, 17196995, 17218385, 17638851, 18519632, 18566326, 18728664, 19091943, 19182535, 19262601, 19466975 View all (106 more)
Neoplasms	Stimulate	24789045, 31133010
Neoplasms	Inhibit	26429164
Neoplasms Cystic Mucinous and Serous	Associate	12910520
Nerve Degeneration	Associate	18490454, 19363261, 28539470
Neural Tube Defects	Associate	7565761
Neuroblastoma	Associate	25264277, 37664946
Neurodegenerative Diseases	Associate	31755389, 36552734
Ovarian Neoplasms	Associate	12910520, 12928725, 19738611
Pancreatic Neoplasms	Associate	25111230
Paraparesis Tropical Spastic	Inhibit	12239143
Paraparesis Tropical Spastic	Associate	32667912
Parkinson Disease	Associate	36552734
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	17555450
Pdgfrb Associated Chronic Eosinophilic Leukemia	Associate	12542482, 16960151, 17296564
Philadelphia Chromosome	Associate	10233416, 10500826, 10520010, 10583263, 10931001, 11091212, 11175620, 11287973, 11861307, 11986206, 12036887, 12663457, 12692414, 12716364, 15039277 View all (119 more)
Philadelphia Chromosome	Stimulate	31638195, 3276362, 34053988, 37109629
Polycythemia	Associate	26187587
Polycythemia Vera	Associate	19109573, 19484334, 26187587, 27111338, 28335073, 29611379, 38386293
Polycythemia Vera	Inhibit	30889303
Precancerous Conditions	Associate	30598579
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Stimulate	19924795
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	20063526, 22848414, 23107779, 23974192, 24366361, 25273558, 27176795, 27447561, 27860260, 27894077, 28063722, 29330417, 30936193, 31944572, 32111748, 32332702, 32902203, 34210682, 8704188 View all (4 more)
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10500826, 10682862, 11054070, 11287973, 11861265, 11861307, 11964322, 12239143, 12410571, 12447959, 12663457, 12750174, 12791662, 1371420, 15039277 View all (154 more)
Precursor Cell Lymphoblastic Leukemia Lymphoma	Stimulate	18519632, 29443727, 32111748
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10468851, 10848838, 11091212, 11121477, 15282669, 15361874, 15713800, 16873673, 17488685, 18322257, 18835836, 21623761, 23521501, 23679247, 23872305 View all (13 more)
Primary Myelofibrosis	Associate	27077777, 27111338, 28335073, 33541399, 34506622, 35731275, 38386293
Prostatic Neoplasms	Associate	20881409, 22075945, 24223753
Prostatitis	Associate	10660600, 8650201
Pruritus	Associate	28224300
Recurrence	Associate	12492591
Renal Insufficiency Chronic	Associate	31257514
Rhabdoid Tumor	Associate	20629032
Scleroderma Systemic	Associate	19180499
Sezary Syndrome	Associate	17768128
Shoulder Pain	Associate	33126303
Sleep Wake Disorders	Inhibit	12511422
Spinal Cord Diseases	Stimulate	31953021
Splenomegaly	Associate	21804629
Squamous Cell Carcinoma of Head and Neck	Associate	23146907, 28984303, 37169211
Stomach Diseases	Associate	34585958
Stomach Neoplasms	Associate	26429164, 34585958
Tetra amelia with ectodermal dysplasia and lacrimal duct abnormalities	Associate	37156894
Thrombocythemia Essential	Associate	27111338, 28335073, 28406068, 28415571, 30602717, 9326244
Thrombocytopenia	Associate	21804629, 28224300, 35731275
Thrombocytosis	Associate	28437552, 34477162, 36354705
Thrombosis	Stimulate	37983208
Thymus Neoplasms	Associate	25418180
Translocation Genetic	Associate	10629574
Triple Negative Breast Neoplasms	Associate	24789045, 25803821, 39819723
Triple Negative Breast Neoplasms	Inhibit	28661474
Tuberculosis Multidrug Resistant	Associate	22957062
Tuberous Sclerosis	Associate	2889832
Typical Teratoid Rhabdoid Tumor	Associate	20629032
Urinary Bladder Neoplasms	Associate	33952249
X Linked Combined Immunodeficiency Diseases	Associate	35941390
Xeroderma pigmentosum variant type	Associate	15050919

ABL1 (ABL proto-oncogene 1, non-receptor tyrosine kinase)