Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2488
Gene name Gene Name - the full gene name approved by the HGNC.	Follicle stimulating hormone subunit beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FSHB
Synonyms (NCBI Gene) Gene synonyms aliases	HH24
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p14.1
Summary Summary of gene provided in NCBI Entrez Gene.	The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta sub

Show/Hide all(59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT643776	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT643775	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT643774	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT643773	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT643772	hsa-miR-616-3p	HITS-CLIP	23824327
MIRT643771	hsa-miR-3671	HITS-CLIP	23824327
MIRT643770	hsa-miR-607	HITS-CLIP	23824327
MIRT643776	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT643775	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT643774	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT643773	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT643772	hsa-miR-616-3p	HITS-CLIP	23824327
MIRT643771	hsa-miR-3671	HITS-CLIP	23824327
MIRT643770	hsa-miR-607	HITS-CLIP	23824327
MIRT643776	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT643775	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT643774	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT643773	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT643772	hsa-miR-616-3p	HITS-CLIP	23824327
MIRT643771	hsa-miR-3671	HITS-CLIP	23824327
MIRT643770	hsa-miR-607	HITS-CLIP	23824327
MIRT643776	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT643775	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT643774	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT643773	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT643772	hsa-miR-616-3p	HITS-CLIP	23824327
MIRT643771	hsa-miR-3671	HITS-CLIP	23824327
MIRT643770	hsa-miR-607	HITS-CLIP	23824327
MIRT1005478	hsa-miR-25	CLIP-seq
MIRT1005479	hsa-miR-32	CLIP-seq
MIRT1005480	hsa-miR-363	CLIP-seq
MIRT1005481	hsa-miR-367	CLIP-seq
MIRT1005482	hsa-miR-411	CLIP-seq
MIRT1005483	hsa-miR-4727-5p	CLIP-seq
MIRT1005484	hsa-miR-4769-3p	CLIP-seq
MIRT1005485	hsa-miR-499a-5p	CLIP-seq
MIRT1005486	hsa-miR-92a	CLIP-seq
MIRT1005487	hsa-miR-92b	CLIP-seq
MIRT1005488	hsa-miR-936	CLIP-seq
MIRT1997994	hsa-miR-186	CLIP-seq
MIRT1997995	hsa-miR-3133	CLIP-seq
MIRT1997996	hsa-miR-4263	CLIP-seq
MIRT1997997	hsa-miR-4436a	CLIP-seq
MIRT1997998	hsa-miR-576-5p	CLIP-seq
MIRT1005482	hsa-miR-411	CLIP-seq
MIRT1005483	hsa-miR-4727-5p	CLIP-seq
MIRT1005484	hsa-miR-4769-3p	CLIP-seq
MIRT2231549	hsa-miR-499-3p	CLIP-seq
MIRT2231550	hsa-miR-499a-3p	CLIP-seq
MIRT1005488	hsa-miR-936	CLIP-seq
MIRT2231549	hsa-miR-499-3p	CLIP-seq
MIRT2231550	hsa-miR-499a-3p	CLIP-seq
MIRT1005478	hsa-miR-25	CLIP-seq
MIRT1005479	hsa-miR-32	CLIP-seq
MIRT1005480	hsa-miR-363	CLIP-seq
MIRT1005481	hsa-miR-367	CLIP-seq
MIRT1005485	hsa-miR-499a-5p	CLIP-seq
MIRT1005486	hsa-miR-92a	CLIP-seq
MIRT1005487	hsa-miR-92b	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
FOXO1	Repression	24065703
LHX3	Activation	23766128
LHX3	Unknown	15271874
PITX1	Unknown	18339718
PITX2	Unknown	18339718

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001541	Process	Ovarian follicle development	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	11222739, 15662415, 22802634
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2494176, 24692546
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14602737
GO:0005737	Component	Cytoplasm	IEA
GO:0006701	Process	Progesterone biosynthetic process	TAS	14557487
GO:0007165	Process	Signal transduction	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEP	14557487
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	24692546
GO:0007283	Process	Spermatogenesis	IEA
GO:0007292	Process	Female gamete generation	TAS	8220432
GO:0007565	Process	Female pregnancy	TAS	8220432
GO:0008284	Process	Positive regulation of cell population proliferation	NAS	20613903
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010893	Process	Positive regulation of steroid biosynthetic process	IDA	2494176
GO:0016913	Function	Follicle-stimulating hormone activity	IBA
GO:0016913	Function	Follicle-stimulating hormone activity	IDA	2494176, 24692546
GO:0016913	Function	Follicle-stimulating hormone activity	IMP	11514332
GO:0016914	Component	Follicle-stimulating hormone complex	IDA	2494176, 24692546
GO:0016914	Component	Follicle-stimulating hormone complex	IPI	11222739
GO:0030335	Process	Positive regulation of cell migration	NAS	20613903
GO:0042699	Process	Follicle-stimulating hormone signaling pathway	IBA
GO:0042699	Process	Follicle-stimulating hormone signaling pathway	IEA
GO:0042699	Process	Follicle-stimulating hormone signaling pathway	NAS	11222739
GO:0045670	Process	Regulation of osteoclast differentiation	IEA
GO:0045780	Process	Positive regulation of bone resorption	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	20613903
GO:0060011	Process	Sertoli cell proliferation	IEA

MIM	HGNC	e!Ensembl
136530	3964	ENSG00000131808

Protein

UniProt ID

P01225

Protein name

Follitropin subunit beta (Follicle-stimulating hormone beta subunit) (FSH-B) (FSH-beta) (Follitropin beta chain)

Protein function

Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream sig

PDB

1FL7 , 1XWD , 4AY9 , 4MQW , 8I2G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00007	Cys_knot	18 → 122	Cystine-knot domain	Domain

Sequence

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP
ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS
YCSFGEMKE

Sequence length

129

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling GnRH signaling pathway Ovarian steroidogenesis		Glycoprotein hormones Hormone ligand-binding receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hypogonadotropic Hypogonadism With Or Without Anosmia	Hypogonadotropic hypogonadism 24 without anosmia	rs374623109, rs5030646, rs5030776, rs121909666, rs5030777	N/A

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenoma	Associate	2824561
Alopecia	Associate	35279334
Azoospermia	Associate	32096339
Depressive Disorder	Associate	37544299
Dysmenorrhea	Associate	11119757
Endometriosis	Associate	26732621, 28901453, 34659133, 36430184, 37909652
Follicle stimulating hormone deficiency isolated	Associate	18402948, 30602350, 32367462
Genital Diseases Female	Associate	26732621
Hypogonadism	Associate	26445243
Idiopathic Hypogonadotropic Hypogonadism	Associate	1730329
Infertility	Associate	26732621, 34992580
Infertility Male	Associate	22000911, 26445243, 26732621
Klinefelter Syndrome	Associate	25052309
Neoplasms	Associate	8200967
Neoplasms Germ Cell and Embryonal	Associate	29179257
Obesity	Associate	11119757
Oligospermia	Associate	22000911, 36908159
Ovarian Neoplasms	Associate	25528498
Perinatal Death	Associate	37544299
Pituitary Neoplasms	Associate	26884293, 2824561
Polycystic Ovary Syndrome	Associate	11119757, 26284813, 26416764, 26732621, 26908109, 27042970, 28068351, 32591571
Polycystic Ovary Syndrome	Stimulate	31549864
Porcine Reproductive and Respiratory Syndrome	Associate	26732621
Prolactinoma	Associate	25313736
Puberty Delayed	Associate	30602350
Reproductive Tract Infections	Associate	37544299
Spermatogenic Failure Nonobstructive Y Linked	Associate	22000911

FSHB (follicle stimulating hormone subunit beta)