Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
245806
Gene name Gene Name - the full gene name approved by the HGNC.
Vestigial like family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VGLL2
Synonyms (NCBI Gene) Gene synonyms aliases
VGL2, VITO1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with a transcriptional enhancer factor 1 (TEF-1) interaction domain. The encoded protein may act as a co-factor of TEF-1 regulated gene expression during skeletal muscle development. Alternatively spliced transcript variants en
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT552960 hsa-miR-1277-5p HITS-CLIP 23313552
MIRT552958 hsa-miR-1295b-5p HITS-CLIP 23313552
MIRT552957 hsa-miR-1912 HITS-CLIP 23313552
MIRT552956 hsa-miR-3130-5p HITS-CLIP 23313552
MIRT552955 hsa-miR-4482-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IEA
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609979 20232 ENSG00000170162
Protein
UniProt ID Q8N8G2
Protein name Transcription cofactor vestigial-like protein 2 (Vgl-2) (Protein VITO1)
Protein function May act as a specific coactivator for the mammalian TEFs. May play a role in the development of skeletal muscles.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07545 Vg_Tdu 79 109 Vestigial/Tondu family Family
Tissue specificity TISSUE SPECIFICITY: Skeletal muscle. {ECO:0000269|PubMed:12617818}.
Sequence
MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTP
ASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSS
KAPRSSGPWRDCSFPMSQRSFPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPA
ALHGHLHQGATEPWHHAHPHHAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYG
PLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAWAGPGGPFASPSGDVAQGLGL
SVDSARRYSLCGASLLS
Sequence length 317
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Associate 26501226, 30181563, 32087612, 34067464, 35452896, 38607246
Hernia Inguinal Associate 34392144
Neoplasms Associate 35766997
Rhabdomyosarcoma Associate 38607246