Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23779
Gene name	Rho GTPase activating protein 8
Gene symbol	ARHGAP8
Synonyms (NCBI Gene)	BPGAP1PP610
Chromosome	22
Chromosome location	22q13.31
Summary	This gene encodes a member of the RHOGAP family. GAP (GTPase-activating) family proteins participate in signaling pathways that regulate cell processes involved in cytoskeletal changes. GAP proteins alternate between an active (GTP-bound) and inactive (GD

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments
MIRT795026	hsa-let-7a	CLIP-seq
MIRT795027	hsa-let-7b	CLIP-seq
MIRT795028	hsa-let-7c	CLIP-seq
MIRT795029	hsa-let-7d	CLIP-seq
MIRT795030	hsa-let-7e	CLIP-seq
MIRT795031	hsa-let-7f	CLIP-seq
MIRT795032	hsa-let-7g	CLIP-seq
MIRT795033	hsa-let-7i	CLIP-seq
MIRT795034	hsa-miR-3659	CLIP-seq
MIRT795035	hsa-miR-3689a-3p	CLIP-seq
MIRT795036	hsa-miR-3689c	CLIP-seq
MIRT795037	hsa-miR-3934	CLIP-seq
MIRT795038	hsa-miR-4458	CLIP-seq
MIRT795039	hsa-miR-4500	CLIP-seq
MIRT795040	hsa-miR-4648	CLIP-seq
MIRT795041	hsa-miR-4654	CLIP-seq
MIRT795042	hsa-miR-4728-5p	CLIP-seq
MIRT795043	hsa-miR-4769-5p	CLIP-seq
MIRT795044	hsa-miR-4797-5p	CLIP-seq
MIRT795045	hsa-miR-552	CLIP-seq
MIRT795046	hsa-miR-759	CLIP-seq
MIRT795047	hsa-miR-98	CLIP-seq
MIRT795026	hsa-let-7a	CLIP-seq
MIRT795027	hsa-let-7b	CLIP-seq
MIRT795028	hsa-let-7c	CLIP-seq
MIRT795029	hsa-let-7d	CLIP-seq
MIRT795030	hsa-let-7e	CLIP-seq
MIRT795031	hsa-let-7f	CLIP-seq
MIRT795032	hsa-let-7g	CLIP-seq
MIRT795033	hsa-let-7i	CLIP-seq
MIRT795048	hsa-miR-1324	CLIP-seq
MIRT795049	hsa-miR-300	CLIP-seq
MIRT795035	hsa-miR-3689a-3p	CLIP-seq
MIRT795036	hsa-miR-3689c	CLIP-seq
MIRT795050	hsa-miR-381	CLIP-seq
MIRT795037	hsa-miR-3934	CLIP-seq
MIRT795038	hsa-miR-4458	CLIP-seq
MIRT795039	hsa-miR-4500	CLIP-seq
MIRT795040	hsa-miR-4648	CLIP-seq
MIRT795041	hsa-miR-4654	CLIP-seq
MIRT795042	hsa-miR-4728-5p	CLIP-seq
MIRT795043	hsa-miR-4769-5p	CLIP-seq
MIRT795051	hsa-miR-519a	CLIP-seq
MIRT795052	hsa-miR-519b-3p	CLIP-seq
MIRT795053	hsa-miR-519c-3p	CLIP-seq
MIRT795045	hsa-miR-552	CLIP-seq
MIRT795047	hsa-miR-98	CLIP-seq
MIRT795026	hsa-let-7a	CLIP-seq
MIRT795027	hsa-let-7b	CLIP-seq
MIRT795028	hsa-let-7c	CLIP-seq
MIRT795029	hsa-let-7d	CLIP-seq
MIRT795030	hsa-let-7e	CLIP-seq
MIRT795031	hsa-let-7f	CLIP-seq
MIRT795032	hsa-let-7g	CLIP-seq
MIRT795033	hsa-let-7i	CLIP-seq
MIRT795048	hsa-miR-1324	CLIP-seq
MIRT795049	hsa-miR-300	CLIP-seq
MIRT795034	hsa-miR-3659	CLIP-seq
MIRT795035	hsa-miR-3689a-3p	CLIP-seq
MIRT795036	hsa-miR-3689c	CLIP-seq
MIRT795050	hsa-miR-381	CLIP-seq
MIRT795037	hsa-miR-3934	CLIP-seq
MIRT2174534	hsa-miR-4255	CLIP-seq
MIRT795038	hsa-miR-4458	CLIP-seq
MIRT2174535	hsa-miR-4480	CLIP-seq
MIRT795039	hsa-miR-4500	CLIP-seq
MIRT795040	hsa-miR-4648	CLIP-seq
MIRT795041	hsa-miR-4654	CLIP-seq
MIRT795042	hsa-miR-4728-5p	CLIP-seq
MIRT795043	hsa-miR-4769-5p	CLIP-seq
MIRT795044	hsa-miR-4797-5p	CLIP-seq
MIRT2174536	hsa-miR-520d-5p	CLIP-seq
MIRT2174537	hsa-miR-524-5p	CLIP-seq
MIRT795045	hsa-miR-552	CLIP-seq
MIRT795046	hsa-miR-759	CLIP-seq
MIRT795047	hsa-miR-98	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	20179103
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	20179103, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IBA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	20179103
GO:2001136	Process	Negative regulation of endocytic recycling	IBA

MIM	HGNC	e!Ensembl
609405	677	ENSG00000241484

P85298

Protein name

Rho GTPase-activating protein 8 (Rho-type GTPase-activating protein 8)

Protein function

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13716	CRAL_TRIO_2	32 → 197	Divergent CRAL/TRIO domain	Domain
PF00620	RhoGAP	241 → 391	RhoGAP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in kidney and placenta. Also expressed in colon, skeletal muscle, small intestine, stomach, and testis. Not detected in brain, liver or spleen. Overexpressed in the majority of colorectal tumors examined. {ECO:0000269|

Sequence

MAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKY
TLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKDGDLTMWPRLVSNSKLKRSS
HLSLPKYWDYRYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHL
KYDQLVIPPEVLRYDEKLQSLHEGRTPPPTKTPPPRPPLPTQQFGVSLQYLKDKNQGELI
PPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILK
TFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRSLPEHNYVVLRYLMGFLHAVS
RESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEYYEKIFSTPEAPGE
HGLAPWEQGSRAAPLQEAVPRTQATGLTKPTLPPSPLMAARRRL

Sequence length

464

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	rs1187087068	RCV004557772

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Bipolar Disorder	Associate	24882193, 29391396
Mental Disorders	Associate	29391396
Uterine Cervical Neoplasms	Associate	18217980

ARHGAP8 (Rho GTPase activating protein 8)