EID1 (EP300 interacting inhibitor of differentiation 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 23741
Gene name EP300 interacting inhibitor of differentiation 1
Gene symbol EID1
Synonyms (NCBI Gene)
C15orf3CRI1EID-1IRO45620PNAS-22PTD014RBP21
Chromosome 15
Chromosome location 15q21.1
miRNA miRNA information provided by mirtarbase database.
735
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (735)
miRTarBase ID miRNA Experiments Reference
MIRT005487 hsa-miR-138-5p Luciferase reporter assayqRT-PCRWestern blotQuantitative proteomic approach 20486779
MIRT005487 hsa-miR-138-5p Luciferase reporter assayqRT-PCRWestern blotQuantitative proteomic approach 20486779
MIRT725546 hsa-miR-32-3p HITS-CLIP 19536157
MIRT725545 hsa-miR-4640-3p HITS-CLIP 19536157
MIRT725544 hsa-miR-4735-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11073990
GO:0003714 Function Transcription corepressor activity IBA
GO:0003714 Function Transcription corepressor activity IEA
GO:0003714 Function Transcription corepressor activity ISS
GO:0005515 Function Protein binding IPI 11073990, 11964378, 15837424, 18557765, 21364888, 24722188, 26085330, 32529326, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
605894 1191 ENSG00000255302
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y6B2
Protein name EP300-interacting inhibitor of differentiation 1 (21 kDa pRb-associated protein) (CREBBP/EP300 inhibitory protein 1) (E1A-like inhibitor of differentiation 1) (EID-1)
Protein function Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellula
PDB 7SMD
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carc
Sequence 
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEE
EEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGA
GYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGC
DEIIDRE
Sequence length 187
Interactions View interactions