EID1 (EP300 interacting inhibitor of differentiation 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23741
Gene name Gene Name - the full gene name approved by the HGNC.
EP300 interacting inhibitor of differentiation 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EID1
Synonyms (NCBI Gene) Gene synonyms aliases
C15orf3, CRI1, EID-1, IRO45620, PNAS-22, PTD014, RBP21
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q21.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(735)
miRTarBase ID miRNA Experiments Reference
MIRT005487 hsa-miR-138-5p Luciferase reporter assay, qRT-PCR, Western blot, Quantitative proteomic approach 20486779
MIRT005487 hsa-miR-138-5p Luciferase reporter assay, qRT-PCR, Western blot, Quantitative proteomic approach 20486779
MIRT725546 hsa-miR-32-3p HITS-CLIP 19536157
MIRT725545 hsa-miR-4640-3p HITS-CLIP 19536157
MIRT725544 hsa-miR-4735-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11073990
GO:0003714 Function Transcription corepressor activity IBA 21873635
GO:0003714 Function Transcription corepressor activity ISS
GO:0005515 Function Protein binding IPI 11073990, 11964378, 15837424, 18557765, 21364888, 24722188
GO:0005634 Component Nucleus IPI 11073990
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605894 1191 ENSG00000255302
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9Y6B2
Protein name EP300-interacting inhibitor of differentiation 1 (21 kDa pRb-associated protein) (CREBBP/EP300 inhibitory protein 1) (E1A-like inhibitor of differentiation 1) (EID-1)
Protein function Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellula
PDB 7SMD
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carc
Sequence 
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEE
EEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGA
GYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGC
DEIIDRE
Sequence length 187
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Mesothelioma Mesothelioma rs121907908, rs387906350, rs387906351 15920167
Show/Hide Text Mining Associations (4)
Associations from Text Mining
Disease Name Relationship Type References
Bipolar Disorder Associate 30503783
Fetal Growth Retardation Associate 35038162
Mesothelioma Malignant Associate 15920167
Pre Eclampsia Inhibit 35038162