Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23604
Gene name Gene Name - the full gene name approved by the HGNC.	Death associated protein kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DAPK2
Synonyms (NCBI Gene) Gene synonyms aliases	DRP-1, DRP1
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q22.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the serine/threonine protein kinase family. This protein contains a N-terminal protein kinase domain followed by a conserved calmodulin-binding domain with significant similarity to that of death-associated prot

Show/Hide all(118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016960	hsa-miR-335-5p	Microarray	18185580
MIRT545496	hsa-miR-548u	PAR-CLIP	21572407
MIRT545495	hsa-miR-7161-5p	PAR-CLIP	21572407
MIRT545494	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT545493	hsa-miR-4744	PAR-CLIP	21572407
MIRT545492	hsa-miR-4509	PAR-CLIP	21572407
MIRT545491	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT545490	hsa-miR-5695	PAR-CLIP	21572407
MIRT545489	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT545488	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT545487	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT545485	hsa-miR-4263	PAR-CLIP	21572407
MIRT545486	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT545496	hsa-miR-548u	PAR-CLIP	21572407
MIRT545495	hsa-miR-7161-5p	PAR-CLIP	21572407
MIRT545494	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT545493	hsa-miR-4744	PAR-CLIP	21572407
MIRT545492	hsa-miR-4509	PAR-CLIP	21572407
MIRT545491	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT545490	hsa-miR-5695	PAR-CLIP	21572407
MIRT545489	hsa-miR-4799-5p	PAR-CLIP	21572407
MIRT545488	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT545487	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT545485	hsa-miR-4263	PAR-CLIP	21572407
MIRT545486	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT923164	hsa-miR-122	CLIP-seq
MIRT923165	hsa-miR-1263	CLIP-seq
MIRT923166	hsa-miR-1321	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT923168	hsa-miR-2909	CLIP-seq
MIRT923169	hsa-miR-3120-5p	CLIP-seq
MIRT923170	hsa-miR-3145-3p	CLIP-seq
MIRT923171	hsa-miR-3150a-3p	CLIP-seq
MIRT923172	hsa-miR-3162-5p	CLIP-seq
MIRT923173	hsa-miR-3175	CLIP-seq
MIRT923174	hsa-miR-3664-5p	CLIP-seq
MIRT923175	hsa-miR-3689a-5p	CLIP-seq
MIRT923176	hsa-miR-3689b	CLIP-seq
MIRT923177	hsa-miR-3689e	CLIP-seq
MIRT923178	hsa-miR-3689f	CLIP-seq
MIRT923179	hsa-miR-376c	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923182	hsa-miR-4522	CLIP-seq
MIRT923183	hsa-miR-4536	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq
MIRT923185	hsa-miR-4739	CLIP-seq
MIRT923186	hsa-miR-4756-5p	CLIP-seq
MIRT923187	hsa-miR-4778-5p	CLIP-seq
MIRT923188	hsa-miR-590-3p	CLIP-seq
MIRT923189	hsa-miR-603	CLIP-seq
MIRT923190	hsa-miR-939	CLIP-seq
MIRT923164	hsa-miR-122	CLIP-seq
MIRT923166	hsa-miR-1321	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT923168	hsa-miR-2909	CLIP-seq
MIRT923172	hsa-miR-3162-5p	CLIP-seq
MIRT1973518	hsa-miR-4292	CLIP-seq
MIRT1973519	hsa-miR-4308	CLIP-seq
MIRT1973520	hsa-miR-4418	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT1973521	hsa-miR-4467	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq
MIRT923185	hsa-miR-4739	CLIP-seq
MIRT923186	hsa-miR-4756-5p	CLIP-seq
MIRT1973522	hsa-miR-509-3-5p	CLIP-seq
MIRT1973523	hsa-miR-509-5p	CLIP-seq
MIRT923164	hsa-miR-122	CLIP-seq
MIRT2209085	hsa-miR-1237	CLIP-seq
MIRT2209086	hsa-miR-1258	CLIP-seq
MIRT2209087	hsa-miR-1285	CLIP-seq
MIRT2209088	hsa-miR-1324	CLIP-seq
MIRT2209089	hsa-miR-1343	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT2209090	hsa-miR-205	CLIP-seq
MIRT2209091	hsa-miR-2861	CLIP-seq
MIRT2209092	hsa-miR-296-5p	CLIP-seq
MIRT2209093	hsa-miR-3125	CLIP-seq
MIRT2209094	hsa-miR-3156-3p	CLIP-seq
MIRT923172	hsa-miR-3162-5p	CLIP-seq
MIRT2209095	hsa-miR-3166	CLIP-seq
MIRT2209096	hsa-miR-3187-5p	CLIP-seq
MIRT2209097	hsa-miR-3607-5p	CLIP-seq
MIRT2209098	hsa-miR-3667-3p	CLIP-seq
MIRT2209099	hsa-miR-378g	CLIP-seq
MIRT2209100	hsa-miR-3916	CLIP-seq
MIRT2209101	hsa-miR-4301	CLIP-seq
MIRT2209102	hsa-miR-4314	CLIP-seq
MIRT1973520	hsa-miR-4418	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT2209103	hsa-miR-4486	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq
MIRT2209104	hsa-miR-4720-3p	CLIP-seq
MIRT2209105	hsa-miR-483-3p	CLIP-seq
MIRT1973522	hsa-miR-509-3-5p	CLIP-seq
MIRT1973523	hsa-miR-509-5p	CLIP-seq
MIRT2209106	hsa-miR-518a-5p	CLIP-seq
MIRT2209107	hsa-miR-527	CLIP-seq
MIRT2209108	hsa-miR-612	CLIP-seq
MIRT2209109	hsa-miR-635	CLIP-seq
MIRT923164	hsa-miR-122	CLIP-seq
MIRT2512967	hsa-miR-129-5p	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT2512968	hsa-miR-3149	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq
MIRT2512969	hsa-miR-4735-5p	CLIP-seq
MIRT2512970	hsa-miR-4775	CLIP-seq
MIRT2512971	hsa-miR-4794	CLIP-seq
MIRT923188	hsa-miR-590-3p	CLIP-seq
MIRT923164	hsa-miR-122	CLIP-seq
MIRT923167	hsa-miR-1912	CLIP-seq
MIRT923180	hsa-miR-4463	CLIP-seq
MIRT923181	hsa-miR-4494	CLIP-seq
MIRT923184	hsa-miR-4695-3p	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
E2F1	Activation	18521079
KLF6	Activation	18521079
SPI1	Unknown	24038216

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	16756490
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005516	Function	Calmodulin binding	IDA	10376525
GO:0005524	Function	ATP binding	IDA	10376525
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	10376525, 10629061
GO:0005794	Component	Golgi apparatus	IDA
GO:0006468	Process	Protein phosphorylation	IDA	10376525
GO:0006915	Process	Apoptotic process	TAS	10629061
GO:0010506	Process	Regulation of autophagy	TAS	16756490
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034423	Component	Autophagosome lumen	IEA
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0035556	Process	Intracellular signal transduction	IDA	10376525
GO:0042802	Function	Identical protein binding	IPI	10629061, 11230133
GO:0042981	Process	Regulation of apoptotic process	TAS	16756490
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043276	Process	Anoikis	IMP	18957423
GO:0046777	Process	Protein autophosphorylation	TAS	16756490
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IMP	24163421
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:2000424	Process	Positive regulation of eosinophil chemotaxis	IMP	24163421
GO:2001242	Process	Regulation of intrinsic apoptotic signaling pathway	IMP	10376525

MIM	HGNC	e!Ensembl
616567	2675	ENSG00000035664

Protein

UniProt ID

Q9UIK4

Protein name

Death-associated protein kinase 2 (DAP kinase 2) (EC 2.7.11.1) (DAP-kinase-related protein 1) (DRP-1)

Protein function

Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell death signals, depending on t

PDB

1WMK , 1WRZ , 1Z9X , 1ZUZ , 1ZWS , 2A27 , 2A2A , 2CKE , 6PAW , 7A6R , 7A6Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	23 → 285	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in neutrophils and eosinophils (PubMed:24163421). Isoform 2 is expressed in embryonic stem cells (at protein level). Isoform 1 is ubiquitously expressed in all tissue types examined with high levels in heart, lung and skeleta

Sequence

MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
ASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKES
LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV
VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKA
LHPRRRSSTS

Sequence length

370

Interactions

View interactions

	KEGG
	Autophagy - animal Pathways in cancer Bladder cancer

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Ulcerative colitis	Ulcerative colitis			GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	30353687, 35029906
Amyotrophic Lateral Sclerosis	Stimulate	40033250
Carcinoma Hepatocellular	Associate	33102579
Colitis Ulcerative	Associate	37090740
Colorectal Neoplasms	Associate	32244500
Death	Associate	11980920
Esophageal Squamous Cell Carcinoma	Associate	35611939
Hypertension	Associate	32227373
Leukemia Myeloid Acute	Inhibit	24038216
Leukemia Promyelocytic Acute	Associate	24038216
Multiple Myeloma	Associate	22267603
Neoplasms	Inhibit	24038216, 26483415, 31116076, 32244500, 33393503
Neoplasms	Associate	30353687
Polycystic Ovary Syndrome	Associate	36060967
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	20096012
Sleep Deprivation	Associate	27788485
Stomach Neoplasms	Associate	22160140
Thyroid Neoplasms	Associate	35459137

DAPK2 (death associated protein kinase 2)