Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23592
Gene name Gene Name - the full gene name approved by the HGNC.
LEM domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LEMD3
Synonyms (NCBI Gene) Gene synonyms aliases
MAN1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This locus encodes a LEM domain-containing protein. The encoded protein functions to antagonize transforming growth factor-beta signaling at the inner nuclear membrane. Two transcript variants encoding different isoforms have been found for this gene. Mut
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs144086377 C>G,T Conflicting-interpretations-of-pathogenicity Missense variant, stop gained, coding sequence variant
rs267607216 G>A Pathogenic Stop gained, coding sequence variant
rs267607217 C>T Pathogenic Stop gained, coding sequence variant
rs749951964 C>A,T Pathogenic Coding sequence variant, stop gained, synonymous variant
rs867412512 C>G Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018252 hsa-miR-335-5p Microarray 18185580
MIRT020835 hsa-miR-155-5p Proteomics 18668040
MIRT023852 hsa-miR-1-3p Proteomics 18668040
MIRT030644 hsa-miR-22-3p Sequencing 20371350
MIRT047520 hsa-miR-10a-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15231748, 15647271, 24407287, 28514442, 32296183
GO:0005637 Component Nuclear inner membrane IDA 15647271
GO:0005639 Component Integral component of nuclear inner membrane IBA 21873635
GO:0006998 Process Nuclear envelope organization IBA 21873635
GO:0016020 Component Membrane TAS 10671519
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607844 28887 ENSG00000174106
Protein
UniProt ID Q9Y2U8
Protein name Inner nuclear membrane protein Man1 (LEM domain-containing protein 3)
Protein function Can function as a specific repressor of TGF-beta, activin, and BMP signaling through its interaction with the R-SMAD proteins. Antagonizes TGF-beta-induced cell proliferation arrest.
PDB 2CH0 , 5ZOJ , 5ZOK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03020 LEM 8 47 LEM domain Domain
PF09402 MSC 520 750 Man1-Src1p-C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver and skeletal muscle.
Sequence
MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRG
NKTRNSNNNNTAAATVAAAGPAAAAAAGMGVRPVSGDLSYLRTPGGLCRISASGPESLLG
GPGGASAAPAAGSKVLLGFSSDESDVEASPRDQAGGGGRKDRASLQYRGLKAPPAPLAAS
EVTNSNSAERRKPHSWWGARRPAGPELQTPPGKDGAVEDEEGEGEDGEERDPETEEPLWA
SRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVLKDDSLSRHRPRRTHSKPLPPLTAK
SAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAAEQGGGCDQVDSSPVPRYRVN
AKKLTPLLPPPLTDMDSTLDSSTGSLLKTNNHIGGGAFSVDSPRIYSNSLPPSAAVAASS
SLRINHANHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGSFSAHYLSMFLLTA
ACLFFLILGLTYLGMRGTGVSEDGELSIENPFGETFGKIQESEKTLMMNTLYKLHDRLAQ
LAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPEE
ELTNITDVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEE
EETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAV
DFLAANESRVRTETRRIGGADFLVWRWIQP
SASCDKILVIPSKVWQGQAFHLDRRNSPPN
SLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLS
PEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRL
RTGLTNSQGSS
Sequence length 911
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nuclear Envelope Breakdown
Initiation of Nuclear Envelope (NE) Reformation
Depolymerisation of the Nuclear Lamina
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Craniosynostosis Craniosynostosis rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs864321680, rs864321681, rs1057517670, rs1064794325, rs1555750816, rs1599823350
Dermatofibrosis lenticularis disseminata Dermatofibrosis lenticularis disseminata, DERMATOFIBROSIS LENTICULARIS DISSEMINATA, ISOLATED rs2136313349, rs2136355335, rs267607216, rs267607217, rs1565776684, rs1565799131, rs1592464882 15489854, 9295073, 16470551
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Unknown
Disease term Disease name Evidence References Source
Renal hypoplasia Congenital hypoplasia of kidney ClinVar
Specific learning disorder Specific learning disability ClinVar
Melorheostosis With Osteopoikilosis melorheostosis with osteopoikilosis GenCC
Isolated Osteopoikilosis isolated osteopoikilosis GenCC
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer's disease without Neurofibrillary tangles Inhibit 36001963
Bone Diseases Associate 17087626
Buschke Ollendorff syndrome Associate 15601644, 17087626, 27267960, 35642708
Carcinoma Non Small Cell Lung Associate 24980784
Developmental Disabilities Associate 19277063
Exostoses Multiple Hereditary Associate 20618940
Liver Cirrhosis Associate 32003753
Melorheostosis Associate 15601644
Mixed sclerosing bone dystrophy Associate 17087626
Muscular Dystrophy Emery Dreifuss Associate 15681850