Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2359
Gene name	Formyl peptide receptor 3
Gene symbol	FPR3
Synonyms (NCBI Gene)	FML2_HUMANFMLP-R-IIFMLPYFPRH1FPRH2FPRL2RMLP-R-I
Chromosome	19
Chromosome location	19q13.41

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT614160	hsa-miR-3912-3p	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT611085	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611084	hsa-miR-572	HITS-CLIP	23824327
MIRT611083	hsa-miR-718	HITS-CLIP	23824327
MIRT1003965	hsa-miR-1	CLIP-seq
MIRT1003966	hsa-miR-141	CLIP-seq
MIRT1003967	hsa-miR-200a	CLIP-seq
MIRT1003968	hsa-miR-206	CLIP-seq
MIRT1003969	hsa-miR-3673	CLIP-seq
MIRT1003970	hsa-miR-3690	CLIP-seq
MIRT1003971	hsa-miR-4254	CLIP-seq
MIRT1003972	hsa-miR-4501	CLIP-seq
MIRT1003973	hsa-miR-4793-5p	CLIP-seq
MIRT1003974	hsa-miR-613	CLIP-seq
MIRT1997577	hsa-miR-3682-5p	CLIP-seq
MIRT1997578	hsa-miR-4528	CLIP-seq
MIRT2388174	hsa-miR-217	CLIP-seq
MIRT2388175	hsa-miR-219-5p	CLIP-seq
MIRT2388176	hsa-miR-3126-3p	CLIP-seq
MIRT2388177	hsa-miR-323-5p	CLIP-seq
MIRT2388178	hsa-miR-3682-3p	CLIP-seq
MIRT2388179	hsa-miR-4445	CLIP-seq
MIRT2388180	hsa-miR-4477a	CLIP-seq
MIRT2388181	hsa-miR-4490	CLIP-seq
MIRT2388182	hsa-miR-4699-3p	CLIP-seq
MIRT2388183	hsa-miR-4738-3p	CLIP-seq
MIRT2388184	hsa-miR-4774-5p	CLIP-seq
MIRT2388185	hsa-miR-4781-3p	CLIP-seq
MIRT2388186	hsa-miR-4782-3p	CLIP-seq
MIRT2388187	hsa-miR-508-3p	CLIP-seq
MIRT2388188	hsa-miR-876-3p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA
GO:0004875	Function	Complement receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004982	Function	N-formyl peptide receptor activity	IBA
GO:0004982	Function	N-formyl peptide receptor activity	TAS	8198572
GO:0005515	Function	Protein binding	IPI	15465011
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8198572
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8198572
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8198572
GO:0023052	Process	Signaling	IEA

MIM	HGNC	e!Ensembl
136539	3828	ENSG00000187474

P25089

Protein name

N-formyl peptide receptor 3 (FMLP-related receptor II) (FMLP-R-II) (Formyl peptide receptor-like 2)

Protein function

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidyli

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	43 → 302	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in various tissues with highest expression in lung. {ECO:0000269|PubMed:15465011}.

Sequence

METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN
TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA
LDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNF
AFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPL
RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI
LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM

Sequence length

353

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Neutrophil extracellular trap formation Staphylococcus aureus infection		G alpha (i) signalling events Formyl peptide receptors bind formyl peptides and many other ligands

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	28351365	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	29364475	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	34735495	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	31330220	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Associate	33256815	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	33408717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	31116781	★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Infection	Associate	32971238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Placental Insufficiency	Associate	33256815	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	29544524	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Associate	31116781	★★★★★ ★☆☆☆☆ Found in Text Mining only
Smoke Inhalation Injury	Stimulate	33078507	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberculosis Meningeal	Inhibit	32971238	★★★★★ ★☆☆☆☆ Found in Text Mining only

FPR3 (formyl peptide receptor 3)