Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2355
Gene name Gene Name - the full gene name approved by the HGNC.
FOS like 2, AP-1 transcription factor subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOSL2
Synonyms (NCBI Gene) Gene synonyms aliases
ACED, FRA2
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p23.2
Summary Summary of gene provided in NCBI Entrez Gene.
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have bee
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048624 hsa-miR-99a-5p CLASH 23622248
MIRT043735 hsa-miR-342-3p CLASH 23622248
MIRT668300 hsa-miR-6808-5p HITS-CLIP 19536157
MIRT668299 hsa-miR-6893-5p HITS-CLIP 19536157
MIRT668298 hsa-miR-940 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000902 Process Cell morphogenesis IEA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 13679379
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601575 3798 ENSG00000075426
Protein
UniProt ID P15408
Protein name Fos-related antigen 2 (FRA-2)
Protein function Controls osteoclast survival and size (By similarity). As a dimer with JUN, activates LIF transcription (By similarity). Activates CEBPB transcription in PGE2-activated osteoblasts (By similarity). {ECO:0000250|UniProtKB:P47930, ECO:0000250|UniP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 122 183 bZIP transcription factor Coiled-coil
Sequence
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL
QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL
EFM
LVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDK
AQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL
Sequence length 326
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Osteoclast differentiation  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adams Oliver syndrome Associate 36197437
Arthritis Rheumatoid Associate 33863328, 36238290
Autism Spectrum Disorder Associate 36197437
Brain Neoplasms Associate 35003395
Breast Neoplasms Associate 22971117, 28393251
Carcinogenesis Associate 26581505
Carcinoma Hepatocellular Associate 30382079
Carcinoma Hepatocellular Stimulate 34458365
Carcinoma Non Small Cell Lung Associate 25375657, 37370246
Carcinoma Squamous Cell Associate 33000177