RBFOX2 (RNA binding fox-1 homolog 2)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 23543
Gene name RNA binding fox-1 homolog 2
Gene symbol RBFOX2
Synonyms (NCBI Gene)
FOX2Fox-2HNRBP2HRNBP2RBM9RTAdJ106I20.3fxh
Chromosome 22
Chromosome location 22q12.3
Summary This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a co
SNPs SNP information provided by dbSNP.
1
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
SNP ID Visualize variation Clinical significance Consequence
rs1555902810 ->A Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
1526
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1526)
miRTarBase ID miRNA Experiments Reference
MIRT007148 hsa-miR-320d Luciferase reporter assay 23418466
MIRT007148 hsa-miR-320d Luciferase reporter assay 23418466
MIRT007149 hsa-miR-498 Luciferase reporter assay 23418466
MIRT007149 hsa-miR-498 Luciferase reporter assay 23418466
MIRT021475 hsa-miR-9-5p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (27)
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IEA
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome ISS
GO:0003676 Function Nucleic acid binding IEA
GO:0003714 Function Transcription corepressor activity IDA 11875103
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
612149 9906 ENSG00000100320
Protein Protein information from UniProt database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43251
Protein name RNA binding protein fox-1 homolog 2 (Fox-1 homolog B) (Hexaribonucleotide-binding protein 2) (RNA-binding motif protein 9) (RNA-binding protein 9) (Repressor of tamoxifen transcriptional activity)
Protein function RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons dur
PDB 2CQ3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 123 → 191 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF12414 Fox-1_C 265 → 362 Calcitonin gene-related peptide regulator C terminal Family
Sequence 
MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDY
AGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTP
KRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKL
HGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLG
NDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVP
PTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD
PYHALAPAASYGVGAVASLYRGGYSRFAPY
Sequence length 390
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    FGFR2 alternative splicing
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
RBFOX2-related congenital heart disorder Likely pathogenic rs2148138686 RCV006249815
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Congenital heart defect Uncertain significance rs769783955 RCV005863872
Show/Hide Text Mining Associations (33)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Retroviral Syndrome Associate 19567509
Breast Neoplasms Associate 25913416, 27911856
Carcinogenesis Associate 27993616, 34180133
Carcinoma Hepatocellular Associate 32525024
Colorectal Neoplasms Associate 18691435
Esophageal Neoplasms Associate 36466711
Heart Defects Congenital Associate 26785492, 27670201, 37165897
Hereditary Breast and Ovarian Cancer Syndrome Associate 21118496
Heredodegenerative Disorders Nervous System Associate 32589925
Hypoplastic Left Heart Syndrome Associate 27485310