PRAME (PRAME nuclear receptor transcriptional regulator)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID 23532
Gene name PRAME nuclear receptor transcriptional regulator
Gene symbol PRAME
Synonyms (NCBI Gene)
CT130MAPEOIP-4OIP4
Chromosome 22
Chromosome location 22q11.22
Summary This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, an
miRNA miRNA information provided by mirtarbase database.
7
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (7)
miRTarBase ID miRNA Experiments Reference
MIRT1259555 hsa-miR-298 CLIP-seq
MIRT1259556 hsa-miR-3942-3p CLIP-seq
MIRT1259557 hsa-miR-4263 CLIP-seq
MIRT1259558 hsa-miR-505 CLIP-seq
MIRT1259559 hsa-miR-576-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
SOX9 Repression 19273910
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (32)
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IDA 21822215
GO:0000785 Component Chromatin IDA 21822215
GO:0005515 Function Protein binding IPI 16179254, 21822215, 23460923
GO:0005634 Component Nucleus IDA 21822215
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606021 9336 ENSG00000185686
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P78395
Protein name Melanoma antigen preferentially expressed in tumors (Opa-interacting protein 4) (OIP-4) (Preferentially expressed antigen of melanoma)
Protein function Substrate-recognition component of a Cul2-RING (CRL2) E3 ubiquitin-protein ligase complex, which mediates ubiquitination of target proteins, leading to their degradation (PubMed:21822215, PubMed:26138980). The CRL2(PRAME) complex mediates ubiqui
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in testis. Detected in samples of kidney, brain and skin. {ECO:0000269|PubMed:9047241}.
Sequence 
MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAA
FDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
VLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVD
LFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEV
TCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQA
LYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVM
LTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMV
WLSANPCPHCGDRTFYDPEPILCPCFMPN
Sequence length 509
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Ovarian serous cystadenocarcinoma Uncertain significance rs770764905 RCV005926948
Show/Hide Text Mining Associations (100)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 27241212
Brain Neoplasms Associate 32317605
Breast Neoplasms Associate 11136822, 18648365, 19291396, 24764584, 34612587, 37610673, 38022619, 40076569
Breast Neoplasms Stimulate 33487792
Calcinosis Cutis Stimulate 35503885
Carcinoma Adenoid Cystic Stimulate 35973038
Carcinoma Basal Cell Associate 35973038
Carcinoma Embryonal Associate 17993720
Carcinoma Merkel Cell Associate 40001006
Carcinoma Non Small Cell Lung Associate 27794402, 37341056