Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23512
Gene name Gene Name - the full gene name approved by the HGNC.
SUZ12 polycomb repressive complex 2 subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SUZ12
Synonyms (NCBI Gene) Gene synonyms aliases
CHET9, IMMAS, JJAZ1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gen
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs771704089 C>T Pathogenic Stop gained, non coding transcript variant, coding sequence variant
rs1131692177 A>T Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs1242271427 G>A Pathogenic Splice donor variant
rs1567840381 A>C Uncertain-significance, pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs1567840389 ->G Pathogenic Frameshift variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004084 hsa-miR-101-3p Western blot 19008416
MIRT007118 hsa-miR-19a-3p Luciferase reporter assay 23451058
MIRT019780 hsa-miR-375 Microarray 20215506
MIRT020638 hsa-miR-155-5p Proteomics 18668040
MIRT021690 hsa-miR-138-5p Western blot;qRT-PCR 21770894
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0001222 Function Transcription corepressor binding IPI 29628311
GO:0001739 Component Sex chromatin IEA
GO:0003682 Function Chromatin binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606245 17101 ENSG00000178691
Protein
UniProt ID Q15022
Protein name Polycomb protein SUZ12 (Chromatin precipitated E2F target 9 protein) (ChET 9 protein) (Joined to JAZF1 protein) (Suppressor of zeste 12 protein homolog)
Protein function Polycomb group (PcG) protein. Component of the PRC2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene (PubMed:15225548, PubMed:15231737, PubMed:1538
PDB 4W2R , 5HYN , 5IJ7 , 5IJ8 , 5LS6 , 5WAI , 5WAK , 5WG6 , 6B3W , 6C23 , 6C24 , 6NQ3 , 6WKR , 7AT8 , 7KSO , 7KSR , 7KTP , 7TD5 , 8EQV , 8FYH , 8T9G , 8TAS , 8TB9 , 8VMI , 8VML , 8VNV , 8VNZ , 9C8U , 9DCH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09733 VEFS-Box 546 680 VEFS-Box of polycomb protein Family
Tissue specificity TISSUE SPECIFICITY: Overexpressed in breast and colon cancer. {ECO:0000269|PubMed:15231737, ECO:0000269|PubMed:15684044}.
Sequence
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSA
AAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSH
RNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPS
NSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMT
VFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPN
ENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVY
HPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQI
EEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHL
VSMHDFNLISIMSIDKAVTK
LREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEK
ALETDSVSGVSKQSKKQKL
Sequence length 739
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Polycomb repressive complex   PRC2 methylates histones and DNA
Oxidative Stress Induced Senescence
PKMTs methylate histone lysines
SUMOylation of chromatin organization proteins
Regulation of PTEN gene transcription
Transcriptional Regulation by E2F6
HCMV Early Events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Breast Cancer Breast cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients 35411083 CBGDA
Weaver Syndrome weaver syndrome, Weaver syndrome N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenosarcoma Associate 33838572
Anemia Aplastic Associate 33166403
Brain Neoplasms Associate 20920292
Breast Neoplasms Associate 16766534, 24434785
Carcinogenesis Associate 23735840, 34667274, 35649353
Carcinoma Hepatocellular Associate 18753137
Carcinoma Merkel Cell Associate 34667274
Carcinoma Non Small Cell Lung Associate 24633887, 25833694
Cardiomyopathies Associate 32620106
Cholangiocarcinoma Associate 24089088