Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23493
Gene name Gene Name - the full gene name approved by the HGNC.
Hes related family bHLH transcription factor with YRPW motif 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HEY2
Synonyms (NCBI Gene) Gene synonyms aliases
CHF1, GRIDLOCK, GRL, HERP1, HESR2, HRT2, bHLHb32
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q22.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deac
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019456 hsa-miR-148b-3p Microarray 17612493
MIRT022041 hsa-miR-128-3p Microarray 17612493
MIRT025160 hsa-miR-181a-5p Microarray 17612493
MIRT710110 hsa-miR-208a-5p HITS-CLIP 19536157
MIRT710109 hsa-miR-208b-5p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
NR2F2 Unknown 23345397
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10692439, 12535671, 16043483, 16293227, 21290414
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 11486045
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604674 4881 ENSG00000135547
Protein
UniProt ID Q9UBP5
Protein name Hairy/enhancer-of-split related with YRPW motif protein 2 (Cardiovascular helix-loop-helix factor 1) (hCHF1) (Class B basic helix-loop-helix protein 32) (bHLHb32) (HES-related repressor protein 2) (Hairy and enhancer of split-related protein 2) (HESR-2) (
Protein function Downstream effector of Notch signaling which may be required for cardiovascular development. Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. Represses transcription by the cardiac transcriptiona
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 49 104 Helix-loop-helix DNA-binding domain Domain
PF07527 Hairy_orange 123 162 Hairy Orange Domain
Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQ
ATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF
Sequence length 337
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Notch signaling pathway
Human papillomavirus infection
Pathways in cancer
Breast cancer
  Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
NOTCH4 Intracellular Domain Regulates Transcription
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Brugada Syndrome Brugada syndrome N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Endometriosis Endometriosis N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aneurysm Inhibit 24768363
Breast Neoplasms Associate 38066300
Brugada Syndrome Associate 24667784, 30193957
Carcinoma Hepatocellular Associate 27191260
Endometrial Neoplasms Associate 34675350
Epidermolysis bullosa with pyloric atresia Associate 25575134
Esophageal Squamous Cell Carcinoma Associate 25361534
Fetal Growth Retardation Associate 29983832
Glioblastoma Associate 23787764
Glioma Inhibit 20838435