Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	23493
Gene name	Hes related family bHLH transcription factor with YRPW motif 2
Gene symbol	HEY2
Synonyms (NCBI Gene)	CHF1GRIDLOCKGRLHERP1HESR2HRT2bHLHb32
Chromosome	6
Chromosome location	6q22.31
Summary	This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deac

149

Show/Hide all (149)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019456	hsa-miR-148b-3p	Microarray	17612493
MIRT022041	hsa-miR-128-3p	Microarray	17612493
MIRT025160	hsa-miR-181a-5p	Microarray	17612493
MIRT710110	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT710109	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT710108	hsa-miR-3121-5p	HITS-CLIP	19536157
MIRT710107	hsa-miR-376b-5p	HITS-CLIP	19536157
MIRT710106	hsa-miR-376c-5p	HITS-CLIP	19536157
MIRT710105	hsa-miR-3691-5p	HITS-CLIP	19536157
MIRT710104	hsa-miR-8056	HITS-CLIP	19536157
MIRT710103	hsa-miR-4326	HITS-CLIP	19536157
MIRT710102	hsa-miR-5701	HITS-CLIP	19536157
MIRT710101	hsa-miR-6833-5p	HITS-CLIP	19536157
MIRT710100	hsa-miR-4752	HITS-CLIP	19536157
MIRT710110	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT710109	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT710108	hsa-miR-3121-5p	HITS-CLIP	19536157
MIRT710107	hsa-miR-376b-5p	HITS-CLIP	19536157
MIRT710106	hsa-miR-376c-5p	HITS-CLIP	19536157
MIRT710105	hsa-miR-3691-5p	HITS-CLIP	19536157
MIRT710104	hsa-miR-8056	HITS-CLIP	19536157
MIRT710103	hsa-miR-4326	HITS-CLIP	19536157
MIRT710102	hsa-miR-5701	HITS-CLIP	19536157
MIRT710101	hsa-miR-6833-5p	HITS-CLIP	19536157
MIRT710100	hsa-miR-4752	HITS-CLIP	19536157
MIRT710110	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT710109	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT710108	hsa-miR-3121-5p	HITS-CLIP	19536157
MIRT710107	hsa-miR-376b-5p	HITS-CLIP	19536157
MIRT710106	hsa-miR-376c-5p	HITS-CLIP	19536157
MIRT710105	hsa-miR-3691-5p	HITS-CLIP	19536157
MIRT710104	hsa-miR-8056	HITS-CLIP	19536157
MIRT710103	hsa-miR-4326	HITS-CLIP	19536157
MIRT710102	hsa-miR-5701	HITS-CLIP	19536157
MIRT710101	hsa-miR-6833-5p	HITS-CLIP	19536157
MIRT710100	hsa-miR-4752	HITS-CLIP	19536157
MIRT445985	hsa-miR-1264	PAR-CLIP	22100165
MIRT445984	hsa-miR-6512-5p	PAR-CLIP	22100165
MIRT445983	hsa-miR-4635	PAR-CLIP	22100165
MIRT445982	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT445980	hsa-miR-4452	PAR-CLIP	22100165
MIRT445981	hsa-miR-6079	PAR-CLIP	22100165
MIRT445985	hsa-miR-1264	PAR-CLIP	22100165
MIRT445984	hsa-miR-6512-5p	PAR-CLIP	22100165
MIRT445983	hsa-miR-4635	PAR-CLIP	22100165
MIRT445982	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT445980	hsa-miR-4452	PAR-CLIP	22100165
MIRT445981	hsa-miR-6079	PAR-CLIP	22100165
MIRT736702	hsa-miR-599	Luciferase reporter assayWestern blottingqRT-PCR	31565805
MIRT710110	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT710109	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT710108	hsa-miR-3121-5p	HITS-CLIP	19536157
MIRT710107	hsa-miR-376b-5p	HITS-CLIP	19536157
MIRT710106	hsa-miR-376c-5p	HITS-CLIP	19536157
MIRT710105	hsa-miR-3691-5p	HITS-CLIP	19536157
MIRT710104	hsa-miR-8056	HITS-CLIP	19536157
MIRT710103	hsa-miR-4326	HITS-CLIP	19536157
MIRT710102	hsa-miR-5701	HITS-CLIP	19536157
MIRT710101	hsa-miR-6833-5p	HITS-CLIP	19536157
MIRT710100	hsa-miR-4752	HITS-CLIP	19536157
MIRT710110	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT710109	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT710108	hsa-miR-3121-5p	HITS-CLIP	19536157
MIRT710107	hsa-miR-376b-5p	HITS-CLIP	19536157
MIRT710106	hsa-miR-376c-5p	HITS-CLIP	19536157
MIRT710105	hsa-miR-3691-5p	HITS-CLIP	19536157
MIRT710104	hsa-miR-8056	HITS-CLIP	19536157
MIRT710103	hsa-miR-4326	HITS-CLIP	19536157
MIRT710102	hsa-miR-5701	HITS-CLIP	19536157
MIRT710101	hsa-miR-6833-5p	HITS-CLIP	19536157
MIRT710100	hsa-miR-4752	HITS-CLIP	19536157
MIRT710110	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT710109	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT710108	hsa-miR-3121-5p	HITS-CLIP	19536157
MIRT710107	hsa-miR-376b-5p	HITS-CLIP	19536157
MIRT710106	hsa-miR-376c-5p	HITS-CLIP	19536157
MIRT710105	hsa-miR-3691-5p	HITS-CLIP	19536157
MIRT710104	hsa-miR-8056	HITS-CLIP	19536157
MIRT710103	hsa-miR-4326	HITS-CLIP	19536157
MIRT710102	hsa-miR-5701	HITS-CLIP	19536157
MIRT710101	hsa-miR-6833-5p	HITS-CLIP	19536157
MIRT710100	hsa-miR-4752	HITS-CLIP	19536157
MIRT445985	hsa-miR-1264	PAR-CLIP	22100165
MIRT445984	hsa-miR-6512-5p	PAR-CLIP	22100165
MIRT445983	hsa-miR-4635	PAR-CLIP	22100165
MIRT445982	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT445980	hsa-miR-4452	PAR-CLIP	22100165
MIRT445981	hsa-miR-6079	PAR-CLIP	22100165
MIRT445985	hsa-miR-1264	PAR-CLIP	22100165
MIRT445984	hsa-miR-6512-5p	PAR-CLIP	22100165
MIRT445983	hsa-miR-4635	PAR-CLIP	22100165
MIRT445982	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT445980	hsa-miR-4452	PAR-CLIP	22100165
MIRT445981	hsa-miR-6079	PAR-CLIP	22100165
MIRT1044805	hsa-miR-25	CLIP-seq
MIRT1044806	hsa-miR-32	CLIP-seq
MIRT1044807	hsa-miR-363	CLIP-seq
MIRT1044808	hsa-miR-367	CLIP-seq
MIRT1044809	hsa-miR-4696	CLIP-seq
MIRT1044810	hsa-miR-92a	CLIP-seq
MIRT1044811	hsa-miR-92b	CLIP-seq
MIRT2009769	hsa-miR-1294	CLIP-seq
MIRT2009770	hsa-miR-371-5p	CLIP-seq
MIRT2009771	hsa-miR-371b-5p	CLIP-seq
MIRT2009772	hsa-miR-3924	CLIP-seq
MIRT2009773	hsa-miR-3977	CLIP-seq
MIRT2009774	hsa-miR-4431	CLIP-seq
MIRT2009775	hsa-miR-4464	CLIP-seq
MIRT2009776	hsa-miR-4639-3p	CLIP-seq
MIRT2009777	hsa-miR-4711-3p	CLIP-seq
MIRT2009778	hsa-miR-4748	CLIP-seq
MIRT2009779	hsa-miR-502-5p	CLIP-seq
MIRT2009780	hsa-miR-592	CLIP-seq
MIRT2242111	hsa-miR-181a	CLIP-seq
MIRT2242112	hsa-miR-181b	CLIP-seq
MIRT2242113	hsa-miR-181c	CLIP-seq
MIRT2242114	hsa-miR-181d	CLIP-seq
MIRT2242115	hsa-miR-203	CLIP-seq
MIRT2242116	hsa-miR-3123	CLIP-seq
MIRT2242117	hsa-miR-3646	CLIP-seq
MIRT2242118	hsa-miR-376c	CLIP-seq
MIRT2009772	hsa-miR-3924	CLIP-seq
MIRT2242119	hsa-miR-3925-5p	CLIP-seq
MIRT2242120	hsa-miR-4262	CLIP-seq
MIRT2242121	hsa-miR-4522	CLIP-seq
MIRT2009776	hsa-miR-4639-3p	CLIP-seq
MIRT2242122	hsa-miR-4694-3p	CLIP-seq
MIRT2242123	hsa-miR-4714-5p	CLIP-seq
MIRT2242124	hsa-miR-4766-5p	CLIP-seq
MIRT2242125	hsa-miR-4802-5p	CLIP-seq
MIRT2242126	hsa-miR-515-5p	CLIP-seq
MIRT2242127	hsa-miR-539	CLIP-seq
MIRT2242128	hsa-miR-548aa	CLIP-seq
MIRT2242129	hsa-miR-765	CLIP-seq
MIRT2242130	hsa-miR-885-5p	CLIP-seq
MIRT2242131	hsa-miR-935	CLIP-seq
MIRT2242132	hsa-miR-936	CLIP-seq
MIRT2388944	hsa-miR-1205	CLIP-seq
MIRT2545753	hsa-miR-1276	CLIP-seq
MIRT2545754	hsa-miR-1470	CLIP-seq
MIRT2545755	hsa-miR-384	CLIP-seq
MIRT2009773	hsa-miR-3977	CLIP-seq
MIRT2545756	hsa-miR-4469	CLIP-seq
MIRT2545757	hsa-miR-4473	CLIP-seq
MIRT2545758	hsa-miR-4667-3p	CLIP-seq
MIRT2009779	hsa-miR-502-5p	CLIP-seq
MIRT2545759	hsa-miR-512-3p	CLIP-seq
MIRT2545760	hsa-miR-520f	CLIP-seq
MIRT2545761	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NR2F2	Unknown	23345397

135

Show/Hide all (135)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10692439, 12535671, 16043483, 16293227, 21290414
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	11486045
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	21290414
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	10692439
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0001568	Process	Blood vessel development	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0003150	Process	Muscular septum morphogenesis	IEA
GO:0003150	Process	Muscular septum morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003161	Process	Cardiac conduction system development	NAS	26786210
GO:0003171	Process	Atrioventricular valve development	IEA
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003180	Process	Aortic valve morphogenesis	TAS	20951801
GO:0003184	Process	Pulmonary valve morphogenesis	IEA
GO:0003184	Process	Pulmonary valve morphogenesis	ISS
GO:0003186	Process	Tricuspid valve morphogenesis	IEA
GO:0003186	Process	Tricuspid valve morphogenesis	ISS
GO:0003195	Process	Tricuspid valve formation	IEA
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	TAS	20951801
GO:0003199	Process	Endocardial cushion to mesenchymal transition involved in heart valve formation	IEA
GO:0003208	Process	Cardiac ventricle morphogenesis	IEA
GO:0003208	Process	Cardiac ventricle morphogenesis	ISS
GO:0003214	Process	Cardiac left ventricle morphogenesis	IEA
GO:0003214	Process	Cardiac left ventricle morphogenesis	ISS
GO:0003215	Process	Cardiac right ventricle morphogenesis	IEA
GO:0003215	Process	Cardiac right ventricle morphogenesis	ISS
GO:0003222	Process	Ventricular trabecula myocardium morphogenesis	IEA
GO:0003300	Process	Cardiac muscle hypertrophy	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15485867
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	11486045, 12535671, 21454491, 23275563, 25416956, 32296183, 33961781, 34819669
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007219	Process	Notch signaling pathway	IBA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	ISS
GO:0007219	Process	Notch signaling pathway	TAS	20951801
GO:0007389	Process	Pattern specification process	IEA
GO:0007507	Process	Heart development	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009948	Process	Anterior/posterior axis specification	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0010460	Process	Positive regulation of heart rate	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0014031	Process	Mesenchymal cell development	IEA
GO:0014031	Process	Mesenchymal cell development	ISS
GO:0014898	Process	Cardiac muscle hypertrophy in response to stress	IEA
GO:0017053	Component	Transcription repressor complex	IDA	11486045
GO:0035910	Process	Ascending aorta morphogenesis	IEA
GO:0035910	Process	Ascending aorta morphogenesis	ISS
GO:0035912	Process	Dorsal aorta morphogenesis	IEA
GO:0035912	Process	Dorsal aorta morphogenesis	ISS
GO:0036304	Process	Umbilical cord morphogenesis	IEA
GO:0036304	Process	Umbilical cord morphogenesis	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	12535671
GO:0043565	Function	Sequence-specific DNA binding	IDA	11486045
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045607	Process	Regulation of inner ear auditory receptor cell differentiation	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12535671, 15485867
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050767	Process	Regulation of neurogenesis	IBA
GO:0051145	Process	Smooth muscle cell differentiation	NAS	10692439
GO:0051151	Process	Negative regulation of smooth muscle cell differentiation	IEA
GO:0051151	Process	Negative regulation of smooth muscle cell differentiation	ISS
GO:0055015	Process	Ventricular cardiac muscle cell development	IEA
GO:0055015	Process	Ventricular cardiac muscle cell development	ISS
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	ISS
GO:0060347	Process	Heart trabecula formation	IEA
GO:0060411	Process	Cardiac septum morphogenesis	IEA
GO:0060411	Process	Cardiac septum morphogenesis	ISS
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060413	Process	Atrial septum morphogenesis	IEA
GO:0060413	Process	Atrial septum morphogenesis	ISS
GO:0060633	Process	Negative regulation of transcription initiation by RNA polymerase II	IDA	10692439
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	ISS
GO:0060837	Process	Blood vessel endothelial cell differentiation	IEA
GO:0060840	Process	Artery development	IEA
GO:0060842	Process	Arterial endothelial cell differentiation	IEA
GO:0060842	Process	Arterial endothelial cell differentiation	ISS
GO:0060948	Process	Cardiac vascular smooth muscle cell development	IEA
GO:0060977	Process	Coronary vasculature morphogenesis	IEA
GO:0061156	Process	Pulmonary artery morphogenesis	IEA
GO:0061156	Process	Pulmonary artery morphogenesis	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	10692439, 16293227
GO:0065004	Process	Protein-DNA complex assembly	IEA
GO:0070168	Process	Negative regulation of biomineral tissue development	IEA
GO:0070168	Process	Negative regulation of biomineral tissue development	ISS
GO:0072359	Process	Circulatory system development	IBA
GO:0072359	Process	Circulatory system development	IEA
GO:0090102	Process	Cochlea development	IEA
GO:0097084	Process	Vascular associated smooth muscle cell development	IEP	15821257
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000723	Process	Negative regulation of cardiac vascular smooth muscle cell differentiation	IEA
GO:2000723	Process	Negative regulation of cardiac vascular smooth muscle cell differentiation	ISS
GO:2001212	Process	Regulation of vasculogenesis	IEA
GO:2001212	Process	Regulation of vasculogenesis	ISS

MIM	HGNC	e!Ensembl
604674	4881	ENSG00000135547

Q9UBP5

Protein name

Hairy/enhancer-of-split related with YRPW motif protein 2 (Cardiovascular helix-loop-helix factor 1) (hCHF1) (Class B basic helix-loop-helix protein 32) (bHLHb32) (HES-related repressor protein 2) (Hairy and enhancer of split-related protein 2) (HESR-2) (

Protein function

Downstream effector of Notch signaling which may be required for cardiovascular development. Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. Represses transcription by the cardiac transcriptiona

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	49 → 104	Helix-loop-helix DNA-binding domain	Domain
PF07527	Hairy_orange	123 → 162	Hairy Orange	Domain

Sequence

MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF

Sequence length

337

Interactions

View interactions

	KEGG		Reactome
	Notch signaling pathway Human papillomavirus infection Pathways in cancer Breast cancer		Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants NOTCH4 Intracellular Domain Regulates Transcription

HEY2 (hes related family bHLH transcription factor with YRPW motif 2)