Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23462
Gene name Gene Name - the full gene name approved by the HGNC.
Hes related family bHLH transcription factor with YRPW motif 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HEY1
Synonyms (NCBI Gene) Gene synonyms aliases
BHLHb31, CHF2, HERP2, HESR1, HRT-1, NERP2, OAF1, hHRT1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q21.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017049 hsa-miR-335-5p Microarray 18185580
MIRT019763 hsa-miR-375 Microarray 20215506
MIRT046126 hsa-miR-30b-5p CLASH 23622248
MIRT1044795 hsa-miR-1207-3p CLIP-seq
MIRT1044796 hsa-miR-132 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
DUX4 Activation 24278031
JUN Activation 15314183
MAML1 Repression 18503747
MSX1 Activation 18201699
NR2F2 Unknown 23345397
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16043483, 21290414
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 11486045
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602953 4880 ENSG00000164683
Protein
UniProt ID Q9Y5J3
Protein name Hairy/enhancer-of-split related with YRPW motif protein 1 (Cardiovascular helix-loop-helix factor 2) (CHF-2) (Class B basic helix-loop-helix protein 31) (bHLHb31) (HES-related repressor protein 1) (Hairy and enhancer of split-related protein 1) (HESR-1) (
Protein function Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3' (PubMed:11095750). Downstream effector of Notch signaling required for cardiovascular development. Specifically required for the Notch-induced endo
PDB 2DB7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 50 105 Helix-loop-helix DNA-binding domain Domain
PF07527 Hairy_orange 121 163 Hairy Orange Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the somitic mesoderm, the central nervous system, the kidney, the heart, nasal epithelium, and limbs.
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLH
TAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW
GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Notch signaling pathway
Human papillomavirus infection
Pathways in cancer
Breast cancer
  Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
NOTCH4 Intracellular Domain Regulates Transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anaplastic oligodendroglioma Anaplastic Oligodendroglioma rs1568504941 21127729
Astrocytoma Astrocytoma, Subependymal Giant Cell Astrocytoma, Juvenile Pilocytic Astrocytoma, Diffuse Astrocytoma, Pilocytic Astrocytoma, Childhood Cerebral Astrocytoma, Cerebral Astrocytoma rs555607708 21127729
Autism spectrum disorder Autism Spectrum Disorders rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728
View all (51 more)
20868653
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
21036696
Unknown
Disease term Disease name Evidence References Source
Oligodendroglioma oligodendroglioma, Adult Oligodendroglioma, Childhood Oligodendroglioma, Well Differentiated Oligodendroglioma 21127729 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Aortic Arch Syndromes Associate 34549899
Brain Neoplasms Associate 24487962
Breast Neoplasms Associate 20010940
Carcinogenesis Associate 34837064
Carcinoma Adenoid Cystic Associate 32025208
Carcinoma Hepatocellular Stimulate 27420998
Carcinoma Hepatocellular Associate 40507937
Carcinoma Renal Cell Associate 27766950, 32432737
Chondrosarcoma Mesenchymal Associate 22034177, 23185413, 24839999, 30819134, 34837064, 35342947, 35672279, 37225644, 40301759
Colorectal Neoplasms Associate 23900217, 30565566