Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23385
Gene name Gene Name - the full gene name approved by the HGNC.
Nicastrin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NCSTN
Synonyms (NCBI Gene) Gene synonyms aliases
ATAG1874
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may be
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387906896 C>T Pathogenic Coding sequence variant, stop gained
rs1085307081 C>G,T Pathogenic Missense variant, coding sequence variant, genic downstream transcript variant, stop gained, downstream transcript variant
rs1347055289 G>A Pathogenic Splice donor variant
rs1553210405 C>T Likely-pathogenic Intron variant, coding sequence variant, missense variant
rs1553210984 G>A Pathogenic Splice donor variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030869 hsa-miR-21-5p Sequencing 20371350
MIRT047572 hsa-miR-10a-5p CLASH 23622248
MIRT042811 hsa-miR-339-5p CLASH 23622248
MIRT039146 hsa-miR-769-5p CLASH 23622248
MIRT038892 hsa-miR-93-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002262 Process Myeloid cell homeostasis IEA
GO:0004175 Function Endopeptidase activity IEA
GO:0005515 Function Protein binding IPI 12297508, 15322109, 15890777, 16641999, 18201567, 19376115, 26094765, 26280335, 29611543, 30559186
GO:0005739 Component Mitochondrion IEA
GO:0005765 Component Lysosomal membrane HDA 17897319
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605254 17091 ENSG00000162736
Protein
UniProt ID Q92542
Protein name Nicastrin
Protein function Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein) (PubMed:10993067, PubMed:12679784,
PDB 2N7Q , 2N7R , 4UIS , 5A63 , 5FN2 , 5FN3 , 5FN4 , 5FN5 , 6IDF , 6IYC , 6LQG , 6LR4 , 7C9I , 7D8X , 7Y5T , 7Y5X , 7Y5Z , 8IM7 , 8K8E , 8KCO , 8KCP , 8KCS , 8KCT , 8KCU , 8OQY , 8OQZ , 8X52 , 8X53 , 8X54
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18266 Ncstrn_small 49 223 Nicastrin small lobe Domain
PF05450 Nicastrin 274 499 Family
Tissue specificity TISSUE SPECIFICITY: Detected in brain (at protein level) (PubMed:10993067). Widely expressed (PubMed:11396676). {ECO:0000269|PubMed:10993067, ECO:0000269|PubMed:11396676}.
Sequence
MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI
GCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAG
LAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPI
FLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHA
VISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVA
SFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVD
SFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQ
PLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALY
ELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQ
DLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLY
EYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARI
FLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
Sequence length 709
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Notch signaling pathway
Alzheimer disease
  Nuclear signaling by ERBB4
Regulated proteolysis of p75NTR
NRIF signals cell death from the nucleus
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
EPH-ephrin mediated repulsion of cells
Neutrophil degranulation
NOTCH3 Activation and Transmission of Signal to the Nucleus
Noncanonical activation of NOTCH3
Amyloid fiber formation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Acne inversa ACNE INVERSA, FAMILIAL, 1 rs1595035030, rs1553211087, rs1553210984, rs387906896, rs1555738837, rs1555738943, rs1085307081, rs1347055289, rs1555738763, rs1555738906, rs1555738903, rs1555738836 20929727, 21495993, 22358060, 21412258, 22622421, 21430701
Alzheimer disease Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
17192785
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Associate 36439123
Alzheimer Disease Associate 11992262, 21364883, 29045054
Breast Neoplasms Associate 24919951
Carcinoma Hepatocellular Associate 19366792
Congenital Hereditary and Neonatal Diseases and Abnormalities Associate 24346801
Hidradenitis Suppurativa Associate 30656721, 32078194, 35368949, 37013170, 37494055
Hidradenitis suppurativa familial Associate 30656721, 32078194, 35368949
Immunologic Deficiency Syndromes Inhibit 15286082
Melanoma Cutaneous Malignant Associate 25953768
Neoplasms Associate 24223915, 25663545