Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2335
Gene name Gene Name - the full gene name approved by the HGNC.	Fibronectin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FN1
Synonyms (NCBI Gene) Gene synonyms aliases	CIG, ED-B, FINC, FN, FNZ, GFND, GFND2, LETS, MSF, SMDCF
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q35
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature p

Show/Hide all(14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs113683179	C>G,T	Pathogenic	Splice donor variant
rs137854488	T>C	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs797044906	C>A	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs869025199	GAG>-	Pathogenic	Inframe deletion, coding sequence variant, genic downstream transcript variant
rs1064795155	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1181638652	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant, synonymous variant
rs1553636502	GTT>-	Uncertain-significance, likely-pathogenic	Inframe deletion, coding sequence variant, genic downstream transcript variant
rs1553658926	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1553658948	C>T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1553659131	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1553667072	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1559604072	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1559609410	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1559616744	C>T	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(456)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004009	hsa-miR-200b-3p	Microarray	17875710
MIRT003959	hsa-miR-200c-3p	Microarray	17875710
MIRT006132	hsa-miR-1-3p	GFP reporter assay, qRT-PCR, Western blot	21924268
MIRT006132	hsa-miR-1-3p	GFP reporter assay, qRT-PCR, Western blot	21924268
MIRT006162	hsa-let-7g-5p	Luciferase reporter assay, Microarray, Western blot	21868760
MIRT006162	hsa-let-7g-5p	Luciferase reporter assay, Microarray, Western blot	21868760
MIRT003959	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21501518
MIRT003959	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21501518
MIRT006132	hsa-miR-1-3p	GFP reporter assay, qRT-PCR, Western blot	21924268
MIRT006162	hsa-let-7g-5p	Luciferase reporter assay, Microarray, Western blot	21868760
MIRT006162	hsa-let-7g-5p	Luciferase reporter assay, Microarray, Western blot	21868760
MIRT003959	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21501518
MIRT003959	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21501518
MIRT006132	hsa-miR-1-3p	GFP reporter assay, qRT-PCR, Western blot	21924268
MIRT006162	hsa-let-7g-5p	Luciferase reporter assay, Microarray, Western blot	21868760
MIRT006162	hsa-let-7g-5p	Luciferase reporter assay, Microarray, Western blot	21868760
MIRT003959	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21501518
MIRT003959	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21501518
MIRT006132	hsa-miR-1-3p	Immunoblot, Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22210864
MIRT006132	hsa-miR-1-3p	Immunoblot, Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22210864
MIRT029079	hsa-miR-26b-5p	Microarray	19088304
MIRT040254	hsa-miR-615-3p	CLASH	23622248
MIRT004009	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23408168
MIRT004009	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23408168
MIRT440632	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440632	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT003959	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28113080
MIRT003959	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28113080
MIRT440632	hsa-miR-218-5p	Microarray	33439992
MIRT440632	hsa-miR-218-5p	Microarray	33439992
MIRT733128	hsa-miR-101-3p	Immunohistochemistry (IHC), Western blotting	31930166
MIRT735238	hsa-miR-432-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31423213
MIRT755976	hsa-miR-34b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38477044
MIRT756086	hsa-miR-202-3p	Western blotting, qRT-PCR	37226011
MIRT999844	hsa-miR-101	CLIP-seq
MIRT999845	hsa-miR-1271	CLIP-seq
MIRT999846	hsa-miR-143	CLIP-seq
MIRT999847	hsa-miR-144	CLIP-seq
MIRT999848	hsa-miR-182	CLIP-seq
MIRT999849	hsa-miR-199a-3p	CLIP-seq
MIRT999850	hsa-miR-199b-3p	CLIP-seq
MIRT999851	hsa-miR-3124-3p	CLIP-seq
MIRT999852	hsa-miR-3129-5p	CLIP-seq
MIRT999853	hsa-miR-3154	CLIP-seq
MIRT999854	hsa-miR-3163	CLIP-seq
MIRT999855	hsa-miR-3185	CLIP-seq
MIRT999856	hsa-miR-320a	CLIP-seq
MIRT999857	hsa-miR-320b	CLIP-seq
MIRT999858	hsa-miR-320c	CLIP-seq
MIRT999859	hsa-miR-320d	CLIP-seq
MIRT999860	hsa-miR-3606	CLIP-seq
MIRT999861	hsa-miR-3616-5p	CLIP-seq
MIRT999862	hsa-miR-3647-5p	CLIP-seq
MIRT999863	hsa-miR-3692	CLIP-seq
MIRT999864	hsa-miR-4257	CLIP-seq
MIRT999865	hsa-miR-4272	CLIP-seq
MIRT999866	hsa-miR-4429	CLIP-seq
MIRT999867	hsa-miR-4504	CLIP-seq
MIRT999868	hsa-miR-4709-3p	CLIP-seq
MIRT999869	hsa-miR-4770	CLIP-seq
MIRT999870	hsa-miR-4795-5p	CLIP-seq
MIRT999871	hsa-miR-573	CLIP-seq
MIRT999872	hsa-miR-885-5p	CLIP-seq
MIRT999873	hsa-miR-921	CLIP-seq
MIRT999874	hsa-miR-96	CLIP-seq
MIRT999875	hsa-miR-3908	CLIP-seq
MIRT999876	hsa-miR-3942-5p	CLIP-seq
MIRT999877	hsa-miR-4703-5p	CLIP-seq
MIRT999878	hsa-miR-4766-3p	CLIP-seq
MIRT999879	hsa-miR-590-3p	CLIP-seq
MIRT999880	hsa-miR-887	CLIP-seq
MIRT999864	hsa-miR-4257	CLIP-seq
MIRT999865	hsa-miR-4272	CLIP-seq
MIRT999844	hsa-miR-101	CLIP-seq
MIRT999847	hsa-miR-144	CLIP-seq
MIRT999844	hsa-miR-101	CLIP-seq
MIRT1548757	hsa-miR-1262	CLIP-seq
MIRT1548758	hsa-miR-1270	CLIP-seq
MIRT999845	hsa-miR-1271	CLIP-seq
MIRT1548759	hsa-miR-127-5p	CLIP-seq
MIRT1548760	hsa-miR-1278	CLIP-seq
MIRT1548761	hsa-miR-128	CLIP-seq
MIRT1548762	hsa-miR-1305	CLIP-seq
MIRT1548763	hsa-miR-1323	CLIP-seq
MIRT1548764	hsa-miR-133a	CLIP-seq
MIRT1548765	hsa-miR-133b	CLIP-seq
MIRT1548766	hsa-miR-139-5p	CLIP-seq
MIRT999847	hsa-miR-144	CLIP-seq
MIRT1548767	hsa-miR-146a	CLIP-seq
MIRT1548768	hsa-miR-146b-5p	CLIP-seq
MIRT999848	hsa-miR-182	CLIP-seq
MIRT1548769	hsa-miR-1911	CLIP-seq
MIRT1548770	hsa-miR-193a-5p	CLIP-seq
MIRT999849	hsa-miR-199a-3p	CLIP-seq
MIRT999850	hsa-miR-199b-3p	CLIP-seq
MIRT1548771	hsa-miR-200b	CLIP-seq
MIRT1548772	hsa-miR-200c	CLIP-seq
MIRT1548773	hsa-miR-217	CLIP-seq
MIRT1548774	hsa-miR-219-1-3p	CLIP-seq
MIRT1548775	hsa-miR-27a	CLIP-seq
MIRT1548776	hsa-miR-27b	CLIP-seq
MIRT1548777	hsa-miR-298	CLIP-seq
MIRT999851	hsa-miR-3124-3p	CLIP-seq
MIRT999852	hsa-miR-3129-5p	CLIP-seq
MIRT1548778	hsa-miR-3135b	CLIP-seq
MIRT1548779	hsa-miR-3144-3p	CLIP-seq
MIRT1548780	hsa-miR-3145-3p	CLIP-seq
MIRT1548781	hsa-miR-3148	CLIP-seq
MIRT1548782	hsa-miR-3158-3p	CLIP-seq
MIRT1548783	hsa-miR-3160-3p	CLIP-seq
MIRT1548784	hsa-miR-3160-5p	CLIP-seq
MIRT999854	hsa-miR-3163	CLIP-seq
MIRT1548785	hsa-miR-3164	CLIP-seq
MIRT1548786	hsa-miR-3174	CLIP-seq
MIRT1548787	hsa-miR-3201	CLIP-seq
MIRT999856	hsa-miR-320a	CLIP-seq
MIRT999857	hsa-miR-320b	CLIP-seq
MIRT999858	hsa-miR-320c	CLIP-seq
MIRT999859	hsa-miR-320d	CLIP-seq
MIRT1548788	hsa-miR-320e	CLIP-seq
MIRT1548789	hsa-miR-337-3p	CLIP-seq
MIRT1548790	hsa-miR-34b	CLIP-seq
MIRT1548791	hsa-miR-3609	CLIP-seq
MIRT1548792	hsa-miR-3653	CLIP-seq
MIRT1548793	hsa-miR-3658	CLIP-seq
MIRT1548794	hsa-miR-3664-3p	CLIP-seq
MIRT1548795	hsa-miR-3685	CLIP-seq
MIRT1548796	hsa-miR-3691-5p	CLIP-seq
MIRT999863	hsa-miR-3692	CLIP-seq
MIRT1548797	hsa-miR-384	CLIP-seq
MIRT1548798	hsa-miR-3944-5p	CLIP-seq
MIRT1548799	hsa-miR-3978	CLIP-seq
MIRT1548800	hsa-miR-4275	CLIP-seq
MIRT1548801	hsa-miR-4282	CLIP-seq
MIRT1548802	hsa-miR-429	CLIP-seq
MIRT1548803	hsa-miR-4318	CLIP-seq
MIRT1548804	hsa-miR-432	CLIP-seq
MIRT1548805	hsa-miR-4326	CLIP-seq
MIRT999866	hsa-miR-4429	CLIP-seq
MIRT1548806	hsa-miR-4434	CLIP-seq
MIRT1548807	hsa-miR-448	CLIP-seq
MIRT1548808	hsa-miR-4487	CLIP-seq
MIRT1548809	hsa-miR-4496	CLIP-seq
MIRT1548810	hsa-miR-4511	CLIP-seq
MIRT1548811	hsa-miR-4516	CLIP-seq
MIRT1548812	hsa-miR-4527	CLIP-seq
MIRT1548813	hsa-miR-4531	CLIP-seq
MIRT1548814	hsa-miR-4640-5p	CLIP-seq
MIRT1548815	hsa-miR-4661-3p	CLIP-seq
MIRT1548816	hsa-miR-4666-3p	CLIP-seq
MIRT1548817	hsa-miR-4677-3p	CLIP-seq
MIRT1548818	hsa-miR-4680-5p	CLIP-seq
MIRT1548819	hsa-miR-4687-5p	CLIP-seq
MIRT1548820	hsa-miR-4691-5p	CLIP-seq
MIRT1548821	hsa-miR-4693-5p	CLIP-seq
MIRT1548822	hsa-miR-4701-3p	CLIP-seq
MIRT1548823	hsa-miR-4712-3p	CLIP-seq
MIRT1548824	hsa-miR-4720-3p	CLIP-seq
MIRT1548825	hsa-miR-4726-5p	CLIP-seq
MIRT1548826	hsa-miR-4729	CLIP-seq
MIRT1548827	hsa-miR-4742-5p	CLIP-seq
MIRT1548828	hsa-miR-4752	CLIP-seq
MIRT1548829	hsa-miR-4767	CLIP-seq
MIRT1548830	hsa-miR-4773	CLIP-seq
MIRT1548831	hsa-miR-4791	CLIP-seq
MIRT1548832	hsa-miR-499-3p	CLIP-seq
MIRT1548833	hsa-miR-499a-3p	CLIP-seq
MIRT1548834	hsa-miR-511	CLIP-seq
MIRT1548835	hsa-miR-520a-5p	CLIP-seq
MIRT1548836	hsa-miR-525-5p	CLIP-seq
MIRT1548837	hsa-miR-539	CLIP-seq
MIRT1548838	hsa-miR-548ah	CLIP-seq
MIRT1548839	hsa-miR-548o	CLIP-seq
MIRT1548840	hsa-miR-548t	CLIP-seq
MIRT1548841	hsa-miR-558	CLIP-seq
MIRT1548842	hsa-miR-571	CLIP-seq
MIRT1548843	hsa-miR-579	CLIP-seq
MIRT1548844	hsa-miR-595	CLIP-seq
MIRT1548845	hsa-miR-604	CLIP-seq
MIRT1548846	hsa-miR-607	CLIP-seq
MIRT1548847	hsa-miR-618	CLIP-seq
MIRT1548848	hsa-miR-620	CLIP-seq
MIRT1548849	hsa-miR-640	CLIP-seq
MIRT1548850	hsa-miR-645	CLIP-seq
MIRT1548851	hsa-miR-647	CLIP-seq
MIRT1548852	hsa-miR-802	CLIP-seq
MIRT1548853	hsa-miR-873	CLIP-seq
MIRT1548854	hsa-miR-892a	CLIP-seq
MIRT1548855	hsa-miR-944	CLIP-seq
MIRT999874	hsa-miR-96	CLIP-seq
MIRT1548758	hsa-miR-1270	CLIP-seq
MIRT1548759	hsa-miR-127-5p	CLIP-seq
MIRT1548767	hsa-miR-146a	CLIP-seq
MIRT1548768	hsa-miR-146b-5p	CLIP-seq
MIRT1548774	hsa-miR-219-1-3p	CLIP-seq
MIRT1548778	hsa-miR-3135b	CLIP-seq
MIRT1548783	hsa-miR-3160-3p	CLIP-seq
MIRT1548788	hsa-miR-320e	CLIP-seq
MIRT1548804	hsa-miR-432	CLIP-seq
MIRT1548806	hsa-miR-4434	CLIP-seq
MIRT1548808	hsa-miR-4487	CLIP-seq
MIRT1548811	hsa-miR-4516	CLIP-seq
MIRT1548813	hsa-miR-4531	CLIP-seq
MIRT1548817	hsa-miR-4677-3p	CLIP-seq
MIRT1548820	hsa-miR-4691-5p	CLIP-seq
MIRT1548835	hsa-miR-520a-5p	CLIP-seq
MIRT1548836	hsa-miR-525-5p	CLIP-seq
MIRT1548841	hsa-miR-558	CLIP-seq
MIRT1548842	hsa-miR-571	CLIP-seq
MIRT1548843	hsa-miR-579	CLIP-seq
MIRT1548848	hsa-miR-620	CLIP-seq
MIRT1548771	hsa-miR-200b	CLIP-seq
MIRT1548772	hsa-miR-200c	CLIP-seq
MIRT999854	hsa-miR-3163	CLIP-seq
MIRT1548802	hsa-miR-429	CLIP-seq
MIRT999844	hsa-miR-101	CLIP-seq
MIRT999847	hsa-miR-144	CLIP-seq
MIRT999854	hsa-miR-3163	CLIP-seq
MIRT1548805	hsa-miR-4326	CLIP-seq
MIRT1548771	hsa-miR-200b	CLIP-seq
MIRT1548772	hsa-miR-200c	CLIP-seq
MIRT1548802	hsa-miR-429	CLIP-seq
MIRT999844	hsa-miR-101	CLIP-seq
MIRT2534178	hsa-miR-105	CLIP-seq
MIRT1548757	hsa-miR-1262	CLIP-seq
MIRT1548758	hsa-miR-1270	CLIP-seq
MIRT1548759	hsa-miR-127-5p	CLIP-seq
MIRT1548762	hsa-miR-1305	CLIP-seq
MIRT1548763	hsa-miR-1323	CLIP-seq
MIRT1548764	hsa-miR-133a	CLIP-seq
MIRT1548765	hsa-miR-133b	CLIP-seq
MIRT999847	hsa-miR-144	CLIP-seq
MIRT2534179	hsa-miR-145	CLIP-seq
MIRT1548767	hsa-miR-146a	CLIP-seq
MIRT1548768	hsa-miR-146b-5p	CLIP-seq
MIRT2534180	hsa-miR-151-3p	CLIP-seq
MIRT2534181	hsa-miR-186	CLIP-seq
MIRT2534182	hsa-miR-1915	CLIP-seq
MIRT1548770	hsa-miR-193a-5p	CLIP-seq
MIRT1548771	hsa-miR-200b	CLIP-seq
MIRT1548772	hsa-miR-200c	CLIP-seq
MIRT1548773	hsa-miR-217	CLIP-seq
MIRT1548774	hsa-miR-219-1-3p	CLIP-seq
MIRT2534183	hsa-miR-219-2-3p	CLIP-seq
MIRT1548775	hsa-miR-27a	CLIP-seq
MIRT1548776	hsa-miR-27b	CLIP-seq
MIRT2534184	hsa-miR-2964a-3p	CLIP-seq
MIRT1548777	hsa-miR-298	CLIP-seq
MIRT2534185	hsa-miR-3065-5p	CLIP-seq
MIRT2534186	hsa-miR-3074-3p	CLIP-seq
MIRT2534187	hsa-miR-3121-3p	CLIP-seq
MIRT999851	hsa-miR-3124-3p	CLIP-seq
MIRT2534188	hsa-miR-3134	CLIP-seq
MIRT1548778	hsa-miR-3135b	CLIP-seq
MIRT1548779	hsa-miR-3144-3p	CLIP-seq
MIRT1548780	hsa-miR-3145-3p	CLIP-seq
MIRT1548781	hsa-miR-3148	CLIP-seq
MIRT2534189	hsa-miR-3153	CLIP-seq
MIRT1548782	hsa-miR-3158-3p	CLIP-seq
MIRT1548783	hsa-miR-3160-3p	CLIP-seq
MIRT1548784	hsa-miR-3160-5p	CLIP-seq
MIRT2534190	hsa-miR-3161	CLIP-seq
MIRT999854	hsa-miR-3163	CLIP-seq
MIRT1548785	hsa-miR-3164	CLIP-seq
MIRT1548788	hsa-miR-320e	CLIP-seq
MIRT1548789	hsa-miR-337-3p	CLIP-seq
MIRT1548790	hsa-miR-34b	CLIP-seq
MIRT1548792	hsa-miR-3653	CLIP-seq
MIRT1548793	hsa-miR-3658	CLIP-seq
MIRT1548794	hsa-miR-3664-3p	CLIP-seq
MIRT2534191	hsa-miR-3671	CLIP-seq
MIRT2534192	hsa-miR-3674	CLIP-seq
MIRT2534193	hsa-miR-3679-3p	CLIP-seq
MIRT1548795	hsa-miR-3685	CLIP-seq
MIRT2534194	hsa-miR-376a	CLIP-seq
MIRT2534195	hsa-miR-376b	CLIP-seq
MIRT1548797	hsa-miR-384	CLIP-seq
MIRT2534196	hsa-miR-3925-3p	CLIP-seq
MIRT1548798	hsa-miR-3944-5p	CLIP-seq
MIRT1548801	hsa-miR-4282	CLIP-seq
MIRT1548802	hsa-miR-429	CLIP-seq
MIRT1548804	hsa-miR-432	CLIP-seq
MIRT2534197	hsa-miR-4328	CLIP-seq
MIRT1548806	hsa-miR-4434	CLIP-seq
MIRT1548807	hsa-miR-448	CLIP-seq
MIRT1548808	hsa-miR-4487	CLIP-seq
MIRT1548809	hsa-miR-4496	CLIP-seq
MIRT1548810	hsa-miR-4511	CLIP-seq
MIRT1548811	hsa-miR-4516	CLIP-seq
MIRT1548812	hsa-miR-4527	CLIP-seq
MIRT1548813	hsa-miR-4531	CLIP-seq
MIRT2534198	hsa-miR-4646-5p	CLIP-seq
MIRT1548816	hsa-miR-4666-3p	CLIP-seq
MIRT2534199	hsa-miR-4668-5p	CLIP-seq
MIRT1548817	hsa-miR-4677-3p	CLIP-seq
MIRT2534200	hsa-miR-4680-3p	CLIP-seq
MIRT1548818	hsa-miR-4680-5p	CLIP-seq
MIRT1548819	hsa-miR-4687-5p	CLIP-seq
MIRT1548820	hsa-miR-4691-5p	CLIP-seq
MIRT1548822	hsa-miR-4701-3p	CLIP-seq
MIRT2534201	hsa-miR-4711-3p	CLIP-seq
MIRT1548823	hsa-miR-4712-3p	CLIP-seq
MIRT1548824	hsa-miR-4720-3p	CLIP-seq
MIRT2534202	hsa-miR-4724-5p	CLIP-seq
MIRT2534203	hsa-miR-4726-3p	CLIP-seq
MIRT1548826	hsa-miR-4729	CLIP-seq
MIRT2534204	hsa-miR-4733-5p	CLIP-seq
MIRT1548827	hsa-miR-4742-5p	CLIP-seq
MIRT2534205	hsa-miR-4760-5p	CLIP-seq
MIRT2534206	hsa-miR-4762-5p	CLIP-seq
MIRT1548830	hsa-miR-4773	CLIP-seq
MIRT2534207	hsa-miR-483-3p	CLIP-seq
MIRT1548832	hsa-miR-499-3p	CLIP-seq
MIRT1548833	hsa-miR-499a-3p	CLIP-seq
MIRT2534208	hsa-miR-508-5p	CLIP-seq
MIRT2534209	hsa-miR-513a-5p	CLIP-seq
MIRT1548835	hsa-miR-520a-5p	CLIP-seq
MIRT1548836	hsa-miR-525-5p	CLIP-seq
MIRT1548837	hsa-miR-539	CLIP-seq
MIRT2534210	hsa-miR-548aa	CLIP-seq
MIRT2534211	hsa-miR-548ac	CLIP-seq
MIRT2534212	hsa-miR-548c-3p	CLIP-seq
MIRT2534213	hsa-miR-548d-3p	CLIP-seq
MIRT1548839	hsa-miR-548o	CLIP-seq
MIRT2534214	hsa-miR-548z	CLIP-seq
MIRT1548841	hsa-miR-558	CLIP-seq
MIRT1548842	hsa-miR-571	CLIP-seq
MIRT1548843	hsa-miR-579	CLIP-seq
MIRT1548844	hsa-miR-595	CLIP-seq
MIRT1548845	hsa-miR-604	CLIP-seq
MIRT1548846	hsa-miR-607	CLIP-seq
MIRT1548847	hsa-miR-618	CLIP-seq
MIRT1548848	hsa-miR-620	CLIP-seq
MIRT2534215	hsa-miR-628-5p	CLIP-seq
MIRT1548849	hsa-miR-640	CLIP-seq
MIRT2534216	hsa-miR-643	CLIP-seq
MIRT1548850	hsa-miR-645	CLIP-seq
MIRT1548851	hsa-miR-647	CLIP-seq
MIRT1548853	hsa-miR-873	CLIP-seq
MIRT1548855	hsa-miR-944	CLIP-seq
MIRT999844	hsa-miR-101	CLIP-seq
MIRT2534178	hsa-miR-105	CLIP-seq
MIRT1548757	hsa-miR-1262	CLIP-seq
MIRT1548758	hsa-miR-1270	CLIP-seq
MIRT1548759	hsa-miR-127-5p	CLIP-seq
MIRT1548762	hsa-miR-1305	CLIP-seq
MIRT1548763	hsa-miR-1323	CLIP-seq
MIRT1548764	hsa-miR-133a	CLIP-seq
MIRT1548765	hsa-miR-133b	CLIP-seq
MIRT999847	hsa-miR-144	CLIP-seq
MIRT2534179	hsa-miR-145	CLIP-seq
MIRT1548767	hsa-miR-146a	CLIP-seq
MIRT1548768	hsa-miR-146b-5p	CLIP-seq
MIRT2534181	hsa-miR-186	CLIP-seq
MIRT2534182	hsa-miR-1915	CLIP-seq
MIRT1548770	hsa-miR-193a-5p	CLIP-seq
MIRT1548771	hsa-miR-200b	CLIP-seq
MIRT1548772	hsa-miR-200c	CLIP-seq
MIRT1548773	hsa-miR-217	CLIP-seq
MIRT1548774	hsa-miR-219-1-3p	CLIP-seq
MIRT2534183	hsa-miR-219-2-3p	CLIP-seq
MIRT2534184	hsa-miR-2964a-3p	CLIP-seq
MIRT1548777	hsa-miR-298	CLIP-seq
MIRT2534185	hsa-miR-3065-5p	CLIP-seq
MIRT999851	hsa-miR-3124-3p	CLIP-seq
MIRT2534188	hsa-miR-3134	CLIP-seq
MIRT1548778	hsa-miR-3135b	CLIP-seq
MIRT1548779	hsa-miR-3144-3p	CLIP-seq
MIRT1548780	hsa-miR-3145-3p	CLIP-seq
MIRT1548781	hsa-miR-3148	CLIP-seq
MIRT2534189	hsa-miR-3153	CLIP-seq
MIRT1548782	hsa-miR-3158-3p	CLIP-seq
MIRT1548783	hsa-miR-3160-3p	CLIP-seq
MIRT1548784	hsa-miR-3160-5p	CLIP-seq
MIRT2534190	hsa-miR-3161	CLIP-seq
MIRT999854	hsa-miR-3163	CLIP-seq
MIRT1548785	hsa-miR-3164	CLIP-seq
MIRT1548788	hsa-miR-320e	CLIP-seq
MIRT1548789	hsa-miR-337-3p	CLIP-seq
MIRT1548790	hsa-miR-34b	CLIP-seq
MIRT1548791	hsa-miR-3609	CLIP-seq
MIRT1548792	hsa-miR-3653	CLIP-seq
MIRT1548793	hsa-miR-3658	CLIP-seq
MIRT1548794	hsa-miR-3664-3p	CLIP-seq
MIRT2534191	hsa-miR-3671	CLIP-seq
MIRT2534192	hsa-miR-3674	CLIP-seq
MIRT1548795	hsa-miR-3685	CLIP-seq
MIRT2534194	hsa-miR-376a	CLIP-seq
MIRT2534195	hsa-miR-376b	CLIP-seq
MIRT1548797	hsa-miR-384	CLIP-seq
MIRT2534196	hsa-miR-3925-3p	CLIP-seq
MIRT1548798	hsa-miR-3944-5p	CLIP-seq
MIRT1548799	hsa-miR-3978	CLIP-seq
MIRT1548800	hsa-miR-4275	CLIP-seq
MIRT1548801	hsa-miR-4282	CLIP-seq
MIRT1548802	hsa-miR-429	CLIP-seq
MIRT1548804	hsa-miR-432	CLIP-seq
MIRT2534197	hsa-miR-4328	CLIP-seq
MIRT1548806	hsa-miR-4434	CLIP-seq
MIRT1548807	hsa-miR-448	CLIP-seq
MIRT1548808	hsa-miR-4487	CLIP-seq
MIRT1548809	hsa-miR-4496	CLIP-seq
MIRT1548810	hsa-miR-4511	CLIP-seq
MIRT1548811	hsa-miR-4516	CLIP-seq
MIRT1548812	hsa-miR-4527	CLIP-seq
MIRT1548813	hsa-miR-4531	CLIP-seq
MIRT2534198	hsa-miR-4646-5p	CLIP-seq
MIRT1548815	hsa-miR-4661-3p	CLIP-seq
MIRT1548816	hsa-miR-4666-3p	CLIP-seq
MIRT2534199	hsa-miR-4668-5p	CLIP-seq
MIRT1548817	hsa-miR-4677-3p	CLIP-seq
MIRT2534200	hsa-miR-4680-3p	CLIP-seq
MIRT1548818	hsa-miR-4680-5p	CLIP-seq
MIRT1548819	hsa-miR-4687-5p	CLIP-seq
MIRT1548820	hsa-miR-4691-5p	CLIP-seq
MIRT1548822	hsa-miR-4701-3p	CLIP-seq
MIRT1548823	hsa-miR-4712-3p	CLIP-seq
MIRT1548824	hsa-miR-4720-3p	CLIP-seq
MIRT2534202	hsa-miR-4724-5p	CLIP-seq
MIRT2534203	hsa-miR-4726-3p	CLIP-seq
MIRT1548826	hsa-miR-4729	CLIP-seq
MIRT2534204	hsa-miR-4733-5p	CLIP-seq
MIRT1548827	hsa-miR-4742-5p	CLIP-seq
MIRT2534205	hsa-miR-4760-5p	CLIP-seq
MIRT2534206	hsa-miR-4762-5p	CLIP-seq
MIRT1548830	hsa-miR-4773	CLIP-seq
MIRT2534207	hsa-miR-483-3p	CLIP-seq
MIRT1548832	hsa-miR-499-3p	CLIP-seq
MIRT1548833	hsa-miR-499a-3p	CLIP-seq
MIRT2534208	hsa-miR-508-5p	CLIP-seq
MIRT1548835	hsa-miR-520a-5p	CLIP-seq
MIRT1548836	hsa-miR-525-5p	CLIP-seq
MIRT1548837	hsa-miR-539	CLIP-seq
MIRT2534210	hsa-miR-548aa	CLIP-seq
MIRT2534211	hsa-miR-548ac	CLIP-seq
MIRT1548838	hsa-miR-548ah	CLIP-seq
MIRT2534212	hsa-miR-548c-3p	CLIP-seq
MIRT2534213	hsa-miR-548d-3p	CLIP-seq
MIRT1548839	hsa-miR-548o	CLIP-seq
MIRT1548840	hsa-miR-548t	CLIP-seq
MIRT2534214	hsa-miR-548z	CLIP-seq
MIRT1548841	hsa-miR-558	CLIP-seq
MIRT1548842	hsa-miR-571	CLIP-seq
MIRT1548843	hsa-miR-579	CLIP-seq
MIRT1548844	hsa-miR-595	CLIP-seq
MIRT1548845	hsa-miR-604	CLIP-seq
MIRT1548846	hsa-miR-607	CLIP-seq
MIRT1548847	hsa-miR-618	CLIP-seq
MIRT1548848	hsa-miR-620	CLIP-seq
MIRT2534215	hsa-miR-628-5p	CLIP-seq
MIRT1548849	hsa-miR-640	CLIP-seq
MIRT2534216	hsa-miR-643	CLIP-seq
MIRT1548850	hsa-miR-645	CLIP-seq
MIRT1548851	hsa-miR-647	CLIP-seq
MIRT1548853	hsa-miR-873	CLIP-seq
MIRT1548855	hsa-miR-944	CLIP-seq

Transcription factors

Show/Hide all(15)

Transcription factor	Regulation	Reference
AR	Unknown	21055159
ATF2	Unknown	10471826
CEBPA	Unknown	1320003
EGR1	Activation	15608673;9933644
EGR1	Unknown	10783396
KLF8	Repression	20728449
NFKB1	Activation	10649441;10867646
NFKB1	Unknown	22223884
PARP1	Unknown	22223884
RELA	Activation	10649441;10867646
RELA	Unknown	22223884
SNAI1	Unknown	22223884
SOX17	Repression	24407731
TWIST1	Activation	20646316
TWIST2	Activation	20646316

Show/Hide all(81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001932	Process	Regulation of protein phosphorylation	IDA	11792823
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	22952693
GO:0005102	Function	Signaling receptor binding	IDA	34089617
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IDA	19738201, 33962943
GO:0005178	Function	Integrin binding	IMP	24658351
GO:0005178	Function	Integrin binding	IPI	11792823
GO:0005201	Function	Extracellular matrix structural constituent	HDA	28344315
GO:0005201	Function	Extracellular matrix structural constituent	ISS
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 23979707, 25037231, 27559042, 28327460, 28675934
GO:0005515	Function	Protein binding	IPI	1400330, 1747115, 2531657, 3141278, 9269765, 9278415, 10627046, 10788510, 11377428, 11773026, 11956183, 12167537, 12225811, 12421310, 12736686, 15165854, 15292204, 16336961, 16457822, 16677310, 17130124, 17849409, 18042364, 18160478, 18243143, 18323857, 18411296, 18713862, 19220903
GO:0005518	Function	Collagen binding	NAS	3024962
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005577	Component	Fibrinogen complex	IDA	3997886
GO:0005577	Component	Fibrinogen complex	IPI	20541508
GO:0005604	Component	Basement membrane	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IDA	15292204
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IDA	15308636
GO:0005886	Component	Plasma membrane	TAS
GO:0006953	Process	Acute-phase response	IEA
GO:0007044	Process	Cell-substrate junction assembly	IBA
GO:0007044	Process	Cell-substrate junction assembly	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	1423622
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007161	Process	Calcium-independent cell-matrix adhesion	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	19126672
GO:0007399	Process	Nervous system development	IBA
GO:0007507	Process	Heart development	IBA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	NAS	10075919
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	25834989
GO:0008360	Process	Regulation of cell shape	IEA
GO:0009611	Process	Response to wounding	NAS	7989369
GO:0010628	Process	Positive regulation of gene expression	IDA	25834989
GO:0014850	Process	Response to muscle activity	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016504	Function	Peptidase activator activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	23658023, 23979707, 25037231, 27559042, 28327460, 28344315, 28675934
GO:0031012	Component	Extracellular matrix	IDA	26571399
GO:0031012	Component	Extracellular matrix	IDA	1632457, 16157329
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0033622	Process	Integrin activation	IMP	24658351
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IDA	16236823, 19126672
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	24658351
GO:0035987	Process	Endodermal cell differentiation	IDA	23154389
GO:0042060	Process	Wound healing	IEA
GO:0042802	Function	Identical protein binding	IPI	17914904, 18042364, 19826086, 19931242, 20541508
GO:0043394	Function	Proteoglycan binding	IBA
GO:0043394	Function	Proteoglycan binding	IDA	29030641
GO:0043542	Process	Endothelial cell migration	IDA	20123964
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	25834989
GO:0051702	Process	Biological process involved in interaction with symbiont	IDA	12167537, 12421310, 19429745
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	19126672
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	21276792
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IDA	11792823
GO:0071635	Process	Negative regulation of transforming growth factor beta production	IDA	25834989
GO:0072378	Process	Blood coagulation, fibrin clot formation	IDA	3997886
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0150102	Process	Negative regulation of monocyte activation	IDA	34089617
GO:0150102	Process	Negative regulation of monocyte activation	IEA
GO:1901166	Process	Neural crest cell migration involved in autonomic nervous system development	IDA	26571399
GO:1904237	Process	Positive regulation of substrate-dependent cell migration, cell attachment to substrate	IDA	25834989

MIM	HGNC	e!Ensembl
135600	3778	ENSG00000115414

Protein

UniProt ID

P02751

Protein name

Fibronectin (FN) (Cold-insoluble globulin) (CIG) [Cleaved into: Anastellin; Ugl-Y1; Ugl-Y2; Ugl-Y3]

Protein function

Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin (PubMed:3024962, PubMed:3593230, PubMed:3900070, PubMed:7989369). Fibronectins are involved in cell adhesion, cell motility, opsonization,

PDB

1E88 , 1E8B , 1FBR , 1FNA , 1FNF , 1FNH , 1J8K , 1O9A , 1OWW , 1Q38 , 1QGB , 1QO6 , 1TTF , 1TTG , 2CG6 , 2CG7 , 2CK2 , 2CKU , 2EC3 , 2FN2 , 2FNB , 2GEE , 2H41 , 2H45 , 2HA1 , 2MNU , 2N1K , 2OCF , 2RKY , 2RKZ , 2RL0 , 3CAL , 3EJH , 3GXE , 3M7P , 3MQL , 3R8Q , 3T1W , 3ZRZ , 4GH7 , 4JE4 , 4JEG , 4LXO , 4MMX , 4MMY , 4MMZ , 4PZ5 , 5DC0 , 5DC4 , 5DC9 , 5DFT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00039	fn1	52 → 87	Fibronectin type I domain	Domain
PF00039	fn1	97 → 135	Fibronectin type I domain	Domain
PF00039	fn1	141 → 179	Fibronectin type I domain	Domain
PF00039	fn1	186 → 225	Fibronectin type I domain	Domain
PF00039	fn1	231 → 270	Fibronectin type I domain	Domain
PF00039	fn1	308 → 342	Fibronectin type I domain	Domain
PF00040	fn2	360 → 401	Fibronectin type II domain	Domain
PF00040	fn2	420 → 461	Fibronectin type II domain	Domain
PF00039	fn1	470 → 508	Fibronectin type I domain	Domain
PF00039	fn1	518 → 555	Fibronectin type I domain	Domain
PF00039	fn1	561 → 599	Fibronectin type I domain	Domain
PF00041	fn3	609 → 692	Fibronectin type III domain	Domain
PF00041	fn3	723 → 801	Fibronectin type III domain	Domain
PF00041	fn3	812 → 891	Fibronectin type III domain	Domain
PF00041	fn3	908 → 988	Fibronectin type III domain	Domain
PF00041	fn3	998 → 1078	Fibronectin type III domain	Domain
PF00041	fn3	1093 → 1163	Fibronectin type III domain	Domain
PF00041	fn3	1175 → 1258	Fibronectin type III domain	Domain
PF00041	fn3	1268 → 1349	Fibronectin type III domain	Domain
PF00041	fn3	1359 → 1439	Fibronectin type III domain	Domain
PF00041	fn3	1449 → 1530	Fibronectin type III domain	Domain
PF00041	fn3	1543 → 1623	Fibronectin type III domain	Domain
PF00041	fn3	1633 → 1713	Fibronectin type III domain	Domain
PF00041	fn3	1723 → 1803	Fibronectin type III domain	Domain
PF00041	fn3	1815 → 1894	Fibronectin type III domain	Domain
PF00041	fn3	1904 → 1984	Fibronectin type III domain	Domain
PF00041	fn3	2110 → 2182	Fibronectin type III domain	Domain
PF00039	fn1	2206 → 2245	Fibronectin type I domain	Domain
PF00039	fn1	2251 → 2288	Fibronectin type I domain	Domain
PF00039	fn1	2295 → 2330	Fibronectin type I domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the inner limiting membrane and around blood vessels in the retina (at protein level) (PubMed:29777959). Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms),

Sequence

MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE

Sequence length

2477

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway Focal adhesion ECM-receptor interaction Regulation of actin cytoskeleton Cytoskeleton in muscle cells AGE-RAGE signaling pathway in diabetic complications Bacterial invasion of epithelial cells Yersinia infection Amoebiasis Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Small cell lung cancer		Platelet degranulation Degradation of the extracellular matrix Extracellular matrix organization Fibronectin matrix formation Cell surface interactions at the vascular wall Molecules associated with elastic fibres Integrin cell surface interactions Syndecan interactions Non-integrin membrane-ECM interactions ECM proteoglycans Integrin signaling GRB2:SOS provides linkage to MAPK signaling for Integrins p130Cas linkage to MAPK signaling for integrins Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) MAP2K and MAPK activation Interleukin-4 and Interleukin-13 signaling Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions Paradoxical activation of RAF signaling by kinase inactive BRAF MET activates PTK2 signaling Post-translational protein phosphorylation Signaling downstream of RAS mutants

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Glomerulopathy with fibronectin deposits	Glomerulopathy with fibronectin deposits 2	rs137854488, rs869025198, rs869025199, rs137854486, rs137854487	N/A
Spondyloenchondrodysplasia	Spondylometaphyseal dysplasia - Sutcliffe type	rs1553667072, rs1553669703, rs1553658926, rs113683179, rs1553659131, rs1181638652	N/A
spondylometaphyseal dysplasia	Spondylometaphyseal dysplasia	rs1553667072, rs1553669703, rs1064795155, rs1559604072, rs1553658926, rs1559609410, rs1559616744, rs1553659131, rs1181638652	N/A

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Fibronectin Glomerulopathy	fibronectin glomerulopathy	N/A	N/A	GenCC
Hypertension	Hypertension	N/A	N/A	GWAS
Kidney Disease	Chronic kidney disease	N/A	N/A	ClinVar
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS

Show/Hide Text Mining Associations (460)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abdominal Abscess	Associate	34238216
Achondrogenesis type 2	Associate	25146392, 39367925
Acute Coronary Syndrome	Associate	33672727
Adenocarcinoma	Associate	15136764, 16158954, 24047237, 35322195, 36171259
Adenocarcinoma Follicular	Associate	16675914
Adenocarcinoma of Lung	Associate	22896658, 33728331
Adenoma	Associate	26749005, 31784980
Adenoma	Stimulate	33516765
Adenoma Pleomorphic	Associate	33727696
Adrenocortical Carcinoma	Associate	32207273, 33626208
Alcoholism	Associate	26403951
Alveolar capillary dysplasia	Associate	38029923
Alzheimer Disease	Associate	37819172, 38605603
Androgen Insensitivity Syndrome	Stimulate	11300459
Anemia Sickle Cell	Associate	15308324, 21088296
Aneurysm	Stimulate	18179910
Anodontia	Associate	26497328
Aortic Aneurysm Abdominal	Associate	21593211
Arachnoiditis	Associate	39755217
Arthritis	Associate	11677248, 15843581, 18838522, 19953231
Arthritis Psoriatic	Associate	10733677, 14680507
Arthritis Reactive	Associate	12810431
Arthritis Rheumatoid	Associate	12428226, 1376652, 14680507, 16778393, 18289383, 22215041, 22339947, 23217276, 36398072
Arthritis Rheumatoid	Stimulate	1616356
Ascites	Associate	16080542, 27500424, 32312959, 34614287
Asthma	Associate	11353845, 19047405, 19710636, 23457493, 28402030, 32155894, 35751199
Asthma	Stimulate	18321931, 26342086
Astrocytoma	Associate	10936787
Ataxia Telangiectasia	Associate	30679601, 35782055
Atherosclerosis	Associate	10074478, 28720870, 35130031, 40649979
Atrial Fibrillation	Stimulate	15020515, 35348192, 37280612
Atrial Fibrillation	Associate	36398072, 37161136
Autoimmune Diseases	Associate	22819856
Axial osteomalacia	Associate	34698138
Bardet Biedl Syndrome	Associate	29539623
Birt Hogg Dube Syndrome	Inhibit	27905298
Blood Coagulation Disorders	Associate	10216094, 24349325, 30314454, 34232570
Blood Platelet Disorders	Associate	17596138
Bone Neoplasms	Associate	31792355
Brain Injuries Diffuse	Associate	40063067
Brain Neoplasms	Stimulate	40621453
Breast Neoplasms	Associate	10359047, 14508113, 15353581, 15509657, 16443928, 18314480, 18765548, 19630967, 19845941, 19948022, 20068563, 20201928, 20489157, 20516121, 20821288 View all (38 more)
Breast Neoplasms	Stimulate	27913195, 34641959
Breast Neoplasms	Inhibit	29934326
Bursitis	Stimulate	27438566
CADASIL	Associate	25190493
calcifying aponeurotic fibroma	Associate	30310176
Calcinosis	Associate	33727696
Calcinosis Cutis	Associate	20489157, 34313250
Cancer Pain	Associate	28911071
Carcinogenesis	Associate	16203624, 18451144, 20032387, 31658331, 32801999, 35782055
Carcinoma	Associate	2459257
Carcinoma Adenoid Cystic	Associate	10359046
Carcinoma Basal Cell	Associate	24485923, 2459257, 3361139
Carcinoma Ductal	Associate	10359047, 23602364
Carcinoma Embryonal	Associate	9566920
Carcinoma Hepatocellular	Associate	15777850, 1668673, 17006932, 23826206, 24833879, 24966965, 2543664, 25609232, 29713327, 34443536, 34571852, 35602894, 36609600
Carcinoma Hepatocellular	Stimulate	26403951, 35982891
Carcinoma in Situ	Stimulate	34866441
Carcinoma Non Small Cell Lung	Associate	15908479, 16203624, 16882662, 26422603, 36567906, 36806318, 37656377, 38216996
Carcinoma Non Small Cell Lung	Stimulate	17237224
Carcinoma Pancreatic Ductal	Associate	25824797, 30451798, 30736807, 31731384, 34007003
Carcinoma Renal Cell	Stimulate	20860816, 22674303
Carcinoma Renal Cell	Associate	22266190, 23139422, 24081675, 24247930, 24862756, 30824757, 31181623, 31774870, 31850854, 31950034, 34688260, 36328501, 37563650
Carcinoma Squamous Cell	Associate	23765377
Carcinoma Squamous Cell	Stimulate	27138192
Cardiomyopathies	Associate	27050951
Cardiomyopathy Dilated	Associate	27050951, 33015184, 39442233, 8705761
Cardiomyopathy Dilated	Stimulate	9815151
Cardiomyopathy Hypertrophic	Associate	37628806
Cardiovascular Diseases	Associate	32174066, 35130031, 36739654
Cartilage Diseases	Associate	11677248, 15843581, 24886251, 26973327, 33248223
Cataract	Stimulate	33274006
Cell Transformation Neoplastic	Associate	20371671
Central Nervous System Diseases	Associate	15491286
Cerebral Amyloid Angiopathy	Associate	32993718
Cerebral Intraventricular Hemorrhage	Associate	32285152
Chagas Disease	Associate	34796122
Cholangitis Sclerosing	Stimulate	34519176
Cholangitis Sclerosing	Associate	37310456
Chondromatosis Synovial	Associate	31273315, 31589790
Chondrosarcoma	Associate	11565810, 18641983, 25024164
Chronic Periodontitis	Associate	24008269
Clubfoot	Associate	35292718
Cognition Disorders	Associate	33942972
Cognitive Dysfunction	Associate	33942972
Colitis Ulcerative	Associate	32871953, 33582126
Colonic Diseases	Associate	28418095, 7535283
Colonic Neoplasms	Associate	21567080, 7961830, 8611404, 9430710
Colorectal Neoplasms	Associate	17192196, 17406357, 19655379, 19794966, 20023414, 20032387, 21567080, 22898815, 24737953, 26015410, 27512995, 29863249, 33625532, 36991138, 37214090, 38102712, 39195201, 39940785 View all (3 more)
Common Variable Immunodeficiency	Inhibit	39373788
Communicable Diseases	Associate	19661180
Compassion Fatigue	Associate	17225872
Congenital disorder of glycosylation type 1A	Associate	34997174
Congenital thrombotic disease due to Protein C deficiency	Associate	35428170
Constriction Pathologic	Stimulate	16327498
Constriction Pathologic	Associate	19751734
Conversion Disorder	Associate	31419955
Corneal Dystrophy Band Shaped	Associate	11371495
Coronary Aneurysm	Associate	29207079
Coronary Artery Disease	Associate	29207079, 31881747, 32513244, 35130031, 40649979, 7626352
COVID 19	Stimulate	32664949, 37964271
COVID 19	Associate	35002537, 35563870, 35938548, 36685671
Coxa Vara	Associate	29100092
Critical Illness	Associate	35563870
Crohn Disease	Associate	18633626, 35692876
Crohn Disease	Stimulate	18839425
Crohn Disease	Inhibit	36444838
Cystic Fibrosis	Associate	19007412
Cytokine Release Syndrome	Stimulate	29215065
Degloving Injuries	Associate	10417618
Dermatitis Allergic Contact	Associate	12167174
Dermatitis Atopic 1	Stimulate	11332203
Diabetes Gestational	Associate	20617897
Diabetes Mellitus	Associate	12388107, 19175688, 21866211, 24095823, 34795670, 35119024, 35240786, 35592524
Diabetes Mellitus	Stimulate	3403725
Diabetes Mellitus Type 1	Associate	16045741, 35650387
Diabetes Mellitus Type 2	Associate	32857885, 33902539, 35281591
Diabetic Cardiomyopathies	Associate	36240130
Diabetic Foot	Associate	27102877
Diabetic Nephropathies	Associate	1552712, 18268355, 26045844, 28954822, 29207157, 31355294, 34087849, 34215202, 34424825, 34557161, 35923621, 37960829
Diabetic Retinopathy	Associate	25695094
Diastrophic dysplasia	Associate	18056413, 25146392
Disease	Associate	31973719
Disease	Stimulate	37525423
Drug Related Side Effects and Adverse Reactions	Associate	31987794
Drug Resistant Epilepsy	Stimulate	23341958
Drug Resistant Epilepsy	Associate	27094248
Dysferlinopathy	Associate	23558685
Ehlers Danlos Syndrome	Inhibit	14970208
Ehlers Danlos Syndrome	Associate	20853426, 31731524
Ehlers Danlos syndrome type 1	Associate	30716086, 31731524
Ehlers Danlos syndrome type 3	Associate	20853426
Ehlers Danlos Syndrome Type IV	Stimulate	28596275
Embryo Loss	Associate	27799304
Enchondromatosis	Associate	25024164
Endocardial Fibroelastosis	Associate	32810435
Endocarditis	Associate	19661180, 32544089
Endocrine System Diseases	Associate	21935603
Endodermal Sinus Tumor	Associate	16306258
Endometrial Neoplasms	Associate	33579227
Endometriosis	Associate	15265761, 31115525, 35303800, 37607964, 9022601
Endometriosis	Inhibit	33029756
Endplate Acetylcholinesterase Deficiency	Associate	39271714
Epidermolysis Bullosa Acquisita	Associate	7684054
Epidermolysis Bullosa Dystrophica	Associate	11698408
Epilepsy	Associate	26742644
Esophageal Neoplasms	Associate	28147311, 32208405
Esophageal Squamous Cell Carcinoma	Associate	28556501, 30241395, 30314454, 33248456, 37026938, 37766459
Exfoliation Syndrome	Associate	30713420, 37108678
Exfoliation Syndrome	Stimulate	33914756
Femur Head Necrosis	Associate	24390218, 28393228, 29750162
Fetal Growth Retardation	Associate	36193846, 38069155
Fetal Growth Retardation	Inhibit	38160601
Fibroadenoma	Associate	26961242
Fibrocartilaginous embolism	Associate	21337395, 30370584, 37525423
Fibroma Desmoplastic	Associate	35174683
Fibrosarcoma	Associate	9933644
Fibrosis	Associate	12689941, 1616356, 19175688, 19681763, 20382434, 23935989, 25477471, 26403951, 27438566, 27967206, 28842322, 28858296, 30496316, 32340273, 32547319 View all (18 more)
Fibrosis	Stimulate	35144413
Focal Infection	Associate	25528892
Frailty	Associate	36554656, 39464190
Fuchs' Endothelial Dystrophy	Associate	26302187
Fuchs' Endothelial Dystrophy	Stimulate	29294389
Gastritis Atrophic	Associate	37868053
Gastroesophageal Reflux	Associate	10487259
Genetic Diseases Inborn	Associate	18268355, 27074166, 31419955
Glaucoma	Associate	28860021, 33746571, 35502038
Glaucoma Open Angle	Associate	28860021, 31529121
Glioblastoma	Associate	10783396, 10936787, 18587533, 21980357, 23238957, 26284619, 28191466, 29158223, 30353492, 30695232, 33917452, 34225581, 34376733, 35327982, 35513291 View all (4 more)
Glioblastoma	Stimulate	33694259, 35538679
Glioma	Associate	17360931, 20646316, 20819642, 24815461, 25748242, 26317904, 27541285, 28161812, 2825464, 28535003, 30048971, 33917452, 35882906
Glomerulonephritis	Associate	33043579
Glomerulonephritis IGA	Associate	18268355, 19693466, 36978098, 40547031
Glomerulonephritis Membranoproliferative	Associate	40120032
Glomerulopathy with fibronectin deposits	Associate	31419955, 33837952, 35395622, 35836154, 36774238, 37801747, 37852577, 38053039, 40120032
Glucose Intolerance	Associate	25303939
Glutamate Monosodium Sensitivity	Associate	29520099
Glycogen Storage Disease Type II	Associate	25214719
Graft vs Host Disease	Associate	23842427
Granulomatosis with Polyangiitis	Associate	25939343
Graves Ophthalmopathy	Stimulate	26599235
Graves Ophthalmopathy	Associate	34383782
Gray Platelet Syndrome	Stimulate	12823356
Gray Platelet Syndrome	Associate	6309863
Head and Neck Neoplasms	Associate	21548989, 36510962
Hearing Loss Bilateral	Associate	31006709
Heart Diseases	Associate	25933374, 34796122
Heart Failure	Associate	36303443
Heart Failure Systolic	Stimulate	36303443
Heat Stress Disorders	Associate	29520099
HEM dysplasia	Associate	39367925
Hemangiosarcoma	Associate	40474296
Hematuria	Associate	31419955, 39368581
Hematuria Benign Familial	Associate	36774238, 39368581
Hemophilia B	Associate	24564349
Hemorrhagic Fever American	Stimulate	24081675
Hepatoblastoma	Associate	17006932
Hereditary Breast and Ovarian Cancer Syndrome	Associate	26961242
Hirschsprung Disease	Associate	30616633, 36738110
HIV Infections	Associate	10403921, 11165927, 1831204, 19710592
Hodgkin Disease	Associate	32235718
Hyperglycemia	Stimulate	1552712, 36240130
Hyperoxia	Stimulate	30508396
Hyperplasia	Stimulate	1616356
Hyperplasia	Associate	35586138
Hypersensitivity Immediate	Associate	27799304
Hypertension	Associate	1739129, 31419955, 36739654
Hypertension	Stimulate	35502038, 40547031
Hypertrophy	Associate	9094991
Hypoplastic Left Heart Syndrome	Associate	32810435
Hypoxia	Associate	16798617, 18507049, 23122428, 24390218
Hypoxia	Stimulate	19412434, 25096400, 35059742
Hypoxia	Inhibit	25961573, 28764685
Hypoxia Brain	Associate	24390218
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	31905709
Idiopathic Noncirrhotic Portal Hypertension	Associate	33884041
Idiopathic Pulmonary Fibrosis	Associate	18478089, 1862087, 25199049, 29074489, 3680524, 40294812
Idiopathic Pulmonary Fibrosis	Stimulate	2461087, 33474654
Idiopathic subglottic tracheal stenosis	Associate	34111429
IgA Vasculitis	Associate	12594231, 12810431, 1877856
Immune System Diseases	Associate	37960829
Immunoglobulin Light chain Amyloidosis	Associate	19211640
Infections	Inhibit	19047405
Infections	Associate	19920174
Infertility	Associate	35663320
Inflammation	Associate	11332203, 18633626, 18945811, 19953231, 20337881, 21206505, 23283995, 25214719, 26342086, 26975422, 27438566, 28842322, 29207079, 29295709, 31006709 View all (10 more)
Inflammation	Stimulate	23217276, 7626352
Inflammatory Breast Neoplasms	Associate	26207636
Insulin Resistance	Associate	36221354
Intervertebral Disc Degeneration	Associate	15340826, 21337395, 22556410, 30370584, 32873329, 35409356
Intervertebral Disc Degeneration	Stimulate	37525423
Intracranial Thrombosis	Associate	37175682
Irritable Bowel Syndrome	Associate	24763552, 33843785
Irritable Bowel Syndrome	Inhibit	25930081
Keloid	Stimulate	2524650, 2760040
Keloid	Associate	35953762
Keratoconus	Associate	11683372, 30029277
Kidney Diseases	Stimulate	11849412, 38401467
Kidney Diseases	Associate	12003994, 18268355, 24040439, 28745050, 29908844, 31419955, 32174066, 36774238
Kidney Failure Chronic	Associate	18268355, 24886251, 33837952, 35836154, 37439962
Kidney Neoplasms	Stimulate	10594789
Kidney Neoplasms	Associate	18567581
Knee Injuries	Associate	25410897
Laryngeal Neoplasms	Associate	28269752
Leiomyoma	Associate	10785229, 18248652, 18555241, 19328471, 22901846, 26409322, 26776909, 27469327, 28212568, 28929861, 29747655, 37231028
Leiomyoma	Stimulate	22925684
Leiomyosarcoma	Associate	37137790
Leukemia	Associate	16854822, 18268283, 20352103, 25961573, 33464167
Leukemia Hairy Cell	Associate	6978742
Leukemia Lymphocytic Chronic B Cell	Associate	16840734, 20011538, 21788521, 8639849
Leukemia Lymphoma Adult T Cell	Associate	2421578
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10973491, 1383271, 35730629, 8611716, 8630410, 9558400, 9746786
Leukemia Myeloid Acute	Associate	15183897, 16854822
Leukemia Prolymphocytic T Cell	Associate	18275431
Leukemia Promyelocytic Acute	Associate	10192429
Leukemia T Cell	Associate	17233818
Liver Cirrhosis	Associate	33884041
Liver Cirrhosis Biliary	Associate	14680507
Liver Diseases	Associate	33884041
Liver Failure	Associate	39805388
Liver Neoplasms	Associate	2543664
Lung Diseases	Stimulate	31882647
Lung Diseases Interstitial	Stimulate	34504485
Lung Diseases Interstitial	Associate	35997276
Lung Injury	Associate	10749747
Lung Neoplasms	Associate	15908479, 17237224, 19568240, 23122428, 25340791, 27484721, 31158229, 33728331, 40294812
Lupus Erythematosus Systemic	Associate	17083624, 7530271, 7684054, 8254055
Lupus Erythematosus Systemic	Inhibit	22215041
Lupus Nephritis	Associate	18268355, 35788359
Lyme Disease	Associate	37471146
Lymphangioleiomyomatosis	Associate	25133674
Lymphatic Metastasis	Inhibit	15022276
Lymphatic Metastasis	Associate	30314454, 32037399, 35821222, 36914422
Lymphatic Metastasis	Stimulate	37026938, 40423510
Lymphoma B Cell	Associate	31146399
Lymphoma Follicular	Associate	35965624
Lymphoma Large B Cell Diffuse	Associate	11535527, 15115829, 21829609, 27825111, 31804739, 32042095, 34980601
Lymphoma Large Cell Anaplastic	Associate	28331184
Macular Degeneration	Associate	31608440
Macular Edema	Associate	33270842
Malignant mesenchymal tumor	Associate	26464698, 27443518, 29934326, 31792355
Marfan Syndrome	Associate	21561146
Medulloblastoma	Associate	25736470
Melanoma	Associate	10471056, 11231317, 12445207, 12519080, 12966436, 15846299, 1629241, 16405722, 16960555, 1703545, 1707057, 17912026, 20489157, 20856146, 24292944 View all (12 more)
Melanoma	Stimulate	19332774
Meningeal Carcinomatosis	Associate	37656377
Meningioma	Associate	18587533
Meningism	Associate	10225941
Mesothelioma	Associate	27605433
Metabolic Diseases	Associate	35240786
Microvascular Angina	Associate	17194713
Migraine without Aura	Associate	24081675
Mitral Valve Insufficiency	Associate	33810615
Mohr Tranebjaerg syndrome	Associate	27094248
Monoclonal Gammopathy of Undetermined Significance	Associate	19001640
Mouth Neoplasms	Associate	20579373, 22297602, 36510962, 37641028
Mucocutaneous Lymph Node Syndrome	Associate	29207079
Multiple Myeloma	Associate	10606891, 11154207, 11495705, 11535527, 11751905, 11882358, 12548578, 1421401, 15015970, 16497971, 18503584, 19001640, 20371671, 25071016, 26601950 View all (8 more)
Multiple Myeloma	Stimulate	12930383
Muscular Dystrophy Duchenne	Associate	20382434
MYH9 Related Disorders	Associate	24165359
Myocarditis	Associate	34796122
N syndrome	Inhibit	30704030
N syndrome	Associate	7691664
Nanophthalmos 1	Associate	35791166
Nasal Polyps	Associate	28804222
Nasopharyngeal Carcinoma	Stimulate	24081675
Nasopharyngeal Carcinoma	Associate	27765529, 28613134, 32281480, 35712071, 37056700, 38050231
Nasopharyngeal Neoplasms	Associate	37915157
Neoplasm Invasiveness	Associate	18386055
Neoplasm Invasiveness	Stimulate	19948022
Neoplasm Metastasis	Associate	12045238, 16080542, 18765548, 20489157, 22085528, 22896658, 24209998, 24294359, 24324730, 24388360, 24390218, 24466266, 25340791, 2543664, 25741138 View all (15 more)
Neoplasm Metastasis	Inhibit	15022276, 24059685, 33728331
Neoplasm Metastasis	Stimulate	24081675, 32207273
Neoplasms	Associate	10081495, 10333228, 10359047, 11162401, 11240828, 11294892, 11495705, 12045238, 12649338, 15141079, 15272279, 15354211, 16080542, 16203624, 16838325 View all (122 more)
Neoplasms	Inhibit	19208746, 20337881
Neoplasms	Stimulate	20585448, 20819642, 24081675, 28288584, 30241395, 33916870, 34093898, 34246802, 36709629, 37800754, 39456895, 40052499, 40423510
Neoplasms Germ Cell and Embryonal	Associate	35811571
Neoplastic Cells Circulating	Associate	32281480
Nephritis Hereditary	Associate	35836154
Nephrogenic Fibrosing Dermopathy	Stimulate	20570839
Nephrolithiasis Calcium Oxalate	Associate	26535688
Nerve Degeneration	Stimulate	15340826
Nerve Degeneration	Associate	24586258, 26463451
Netherton Syndrome	Stimulate	19693466
Neuroblastoma	Associate	24069378, 2784439, 2888312, 3772296, 37947594
Neurodegenerative Diseases	Associate	16805856, 30679601, 31746390
Neurofibrosarcoma	Associate	29332262, 30883338
Nevus	Associate	3722858
Non Muscle Invasive Bladder Neoplasms	Associate	22228636
Non Muscle Invasive Bladder Neoplasms	Stimulate	36914422
Norrie disease	Inhibit	25749011
Nose Diseases	Associate	25939343
Obesity	Associate	27792870, 33902539, 34964707, 35240786, 39464190
Odontoma	Associate	28842322
Oncocytoma renal	Associate	20412129
Oncogenic osteomalacia	Associate	29380000
Optic Nerve Diseases	Stimulate	40160813
Organizing Pneumonia	Associate	23842427
Osteoarthritis	Associate	14680507, 18289383, 19723327, 23460186, 24886251, 25410897, 26295224, 26973327, 27449198, 29804557, 30704030, 30760380, 31068249, 32255771, 32832544 View all (11 more)
Osteoarthritis Knee	Associate	24886251
Osteochondrodysplasias	Associate	18056413
Osteogenesis Imperfecta	Associate	27799304
Osteosarcoma	Associate	10216094, 18626747, 29048621, 30975024, 35578666
Osteosarcoma	Stimulate	30691475
Ovarian Neoplasms	Associate	11733357, 12649338, 16080542, 17383746, 19246646, 23326605, 23895273, 25050916, 28944870, 30256042, 30618037, 31936272, 32635925, 33109151, 33629295 View all (6 more)
Pancreatic Neoplasms	Associate	15354211, 18754866, 22015969, 22457533, 30736807, 31208372, 35979350, 36061357
Pancreatic Neoplasms	Stimulate	35428170
Pancreatitis	Associate	28418095
Pancreatitis Chronic	Associate	18053242
Papillary Thyroid Microcarcinoma	Associate	34856364
Paratuberculosis	Associate	11953410
Pediatric Obesity	Associate	32285152
Pemphigoid Benign Mucous Membrane	Associate	37690517
Peri Implantitis	Associate	24008269, 34931168
Periodic fever familial autosomal dominant	Associate	30096958
Periodontal Diseases	Associate	15681151, 19953231
Periodontitis	Associate	18838522, 27531006
Peritoneal Fibrosis	Associate	23418565
Personality Disorders	Associate	36609600
Phyllodes Tumor	Associate	26961242
Plasmacytoma anaplastic	Stimulate	12930383
Pleural Effusion Malignant	Stimulate	27487135
POEMS Syndrome	Associate	18839437
Polycystic Kidney Autosomal Dominant	Associate	22174924
Polycystic Ovary Syndrome	Associate	32482257, 35141985
Porphyria Cutanea Tarda	Associate	27779685
Post Infectious Disorders	Associate	37471146
Pre Eclampsia	Associate	21075447, 25528892, 26654447, 35455936
Pre Eclampsia	Stimulate	22570525
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	11399509
Primary Myelofibrosis	Associate	12689941, 25498831
Primary Myelofibrosis	Stimulate	29359451
Prostatic Hyperplasia	Stimulate	26097605
Prostatic Neoplasms	Associate	10329586, 14523021, 15500293, 16886606, 17912026, 18729104, 22378065, 23261429, 24132461, 24504141, 27590631, 27693493, 27926483, 29391407, 31636091 View all (4 more)
Prostatic Neoplasms Castration Resistant	Associate	28836852
Prostatitis	Associate	16756721, 17438134, 27693493, 29021221
Proteinuria	Associate	18268355, 26045844, 31419955
Psoriasis	Associate	10733677
Pterygium	Stimulate	16446702
Pulmonary Disease Chronic Obstructive	Associate	19047405, 21980461, 25745049, 31920121
Pulmonary Disease Chronic Obstructive	Stimulate	34210319, 36430467
Pulmonary Fibrosis	Stimulate	26038391
Pulmonary Fibrosis	Associate	28005397
Radicular Cyst	Associate	30382180
Rectal Neoplasms	Stimulate	34214117
Renal Insufficiency	Stimulate	33837952
Renal Insufficiency Chronic	Associate	25477471, 36774238
Respiratory Distress Syndrome	Associate	40063067
Respiratory Tract Infections	Inhibit	7962645
Retinal Neovascularization	Associate	34795670
Retinal Perforations	Inhibit	37203077
Retinal Vein Occlusion	Associate	33270842, 36820679
Sarcoidosis	Stimulate	27259755
Sarcoma	Associate	26055407
Sarcoma Ewing	Inhibit	35578666
Sarcoma Ewing	Associate	36478349
Sarcoma Kaposi	Inhibit	11165927
Schimke immunoosseous dysplasia	Associate	25849153
Scleroderma Systemic	Associate	26360820, 29720235, 34344444, 34504485
Scoliosis	Associate	29100092
Sick Sinus Syndrome	Associate	10403921, 19794966
Sjogren's Syndrome	Associate	38128705
Skeletal Defects Genital Hypoplasia And Mental Retardation	Associate	25146392
Skin Neoplasms	Associate	31299490, 35263398
Small Cell Lung Carcinoma	Associate	12927054, 37926756
Soft Tissue Injuries	Associate	31273315, 33727696
Spinal Cord Diseases	Associate	31746390
Spinal Cord Injuries	Associate	33595805
Spondylometaphyseal dysplasia 'corner fracture' type	Associate	29100092
Squamous Cell Carcinoma of Head and Neck	Associate	10576667, 19835631, 20579373, 20930522, 23765377, 25860510, 26040981, 28095396, 28102238, 30249886, 31304688, 33318468, 33723940, 33892811, 35088888, 36245368, 36510962, 39376501, 9228073 View all (4 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	37640804
Squamous Cell Carcinoma of Head and Neck	Inhibit	40004538
ST Elevation Myocardial Infarction	Associate	34227921, 34360827
Status Asthmaticus	Associate	11332203, 24875618, 26342086, 26975422
Status Asthmaticus	Inhibit	20110557
Status Asthmaticus	Stimulate	21864337, 27297409, 33245228
Stomach Neoplasms	Associate	17601708, 21034459, 25350954, 27487135, 27583849, 28485806, 30948703, 31127138, 31658331, 32801999, 32908877, 33015179, 33446695, 33780362, 34126961 View all (8 more)
Strudwick syndrome	Associate	29100092, 30051459
Systemic Inflammatory Response Syndrome	Associate	8118041
T Lymphocytopenia Idiopathic CD4 Positive	Associate	18839437
Thrombasthenia	Associate	6826726
Thrombosis	Associate	2543664, 35938548
Thymoma	Associate	8456937
Thyroid cancer medullary	Associate	29739896
Thyroid Cancer Papillary	Associate	11752453, 15272279, 17914110, 24947099, 27779685, 28849102, 30214625, 30414611, 30872410, 32994394, 33521130, 34522174, 37158852, 37733241, 40423510
Thyroid Carcinoma Anaplastic	Associate	31922212
Thyroid Neoplasms	Associate	15272279, 16675914, 30872410, 32164602, 32337286, 32793117, 34221185, 34791326, 37219859, 37664917
Thyroid Nodule	Associate	32164602
Thyroiditis Autoimmune	Associate	11472420
Thyroiditis Autoimmune	Stimulate	36834770
Tongue Neoplasms	Associate	28095396
Tourette Syndrome	Associate	27391808, 28472652
Triple Negative Breast Neoplasms	Associate	31882647, 31892549, 36922898, 37500797, 40438115
Trophoblastic Neoplasms	Associate	38160601
Tuberculosis Meningeal	Associate	37607964
Ureteral Neoplasms	Stimulate	34862858
Ureteral Obstruction	Stimulate	35443864
Urinary Bladder Neoplasms	Associate	15385489, 18386055, 22228636, 26456754, 30689556, 32228629, 33007314, 33204728, 33962392, 37016361, 39342212
Urinary Bladder Neurogenic	Stimulate	35662268
Uterine Cervical Dysplasia	Associate	36768853
Uterine Cervical Neoplasms	Associate	16788844, 26148476, 34651664
Uterine Diseases	Associate	35303800
Uveal melanoma	Associate	33120861
Varicocele	Associate	31006709
Varicose Ulcer	Associate	10487259, 36250733
Varicose Ulcer	Stimulate	14603222
Varicose Veins	Inhibit	12208777
Vascular Calcification	Associate	35313524
Vascular Diseases	Associate	35692876, 9094991
Vasculitis	Associate	8254055
Ventricular Remodeling	Associate	23457493, 27126693, 28402030, 8705761
Virus Diseases	Associate	29093555, 36398072
Vision Disorders	Associate	33270842
Vitreoretinopathy Proliferative	Associate	23457620, 35579905
von Hippel Lindau Disease	Associate	14706840
Waardenburg Syndrome	Associate	1670751
Werner Syndrome	Associate	1712899
Whooping Cough	Inhibit	7962645

FN1 (fibronectin 1)